gfff Error: invalid command. mode : %s bootcmd : %s loadfmt : %s loadport : %s consoleport : %s serverip : %s servermac : %s devip : %s devmac : %s kpath : %s fpath : %s kcmdline : %s mode bootcmd loadfmt loadport consoleport serverip servermac devip devmac kpath fpath kcmdline Are you sure? Warning: flash write error - flash not erased; Aborting Press .... help - Displays this report. menu - Switch to menu base UI. boot - Boots the kernel. The kernel choosen is the one loaded in ram otherwise the XIP one in Flash. boot_auto - Boots the kernel. The kernel unless there isn't one, in which case the one in flash is used. The boot operation will automatically xfer the kernel and/or filesystem from flash to ram only *if* needed prior to jumping to the kernel. No xfer takes place for XIP components in flash. def - Runs the "default boot cmd" set - By itself, shows current settings. To change a setting use following form: set [param] [value] param | Typical Value ------------+-------------- mode | menu or cmd bootcmd | copy -c k -s e -d r -f rrbin; boot loadfmt | srec or rrbin loadport | ser par or eth consoleport | ser par or usb serverip | nn.nn.nn.nn servermac | nn:nn:nn:nn:nn:nn devip | nn.nn.nn.nn devmac | nn:nn:nn:nn:nn:nn kpath | fpath | kcmdline | copy -c [comp] -s [src] -d [dest] -f [format] Tells bootloader to copy comp image from src to dest. where comp = [b]ootldr | [p]arams | [k]ernel | [f]ilesys where src&dest = [r]am | [f]lash | [e]ther | [s]erial | [p]ar where format = [n]otapplicable | [s]rec | [r]rbin eraseflash [comp] where comp = [b]ootldr | [p]arams | [k]ernel | [f]ilesys | [a]ll Erase Flash Sector ----------------------- 0. --to Erase Menu--
. Hex address in the sector to be erased Which? Press enter to continue Invalid hexidemical number (use 0-9, A-F, a-f): %s Erase [comp] from Flash 0. --to MAIN-- 1. Erase [BootLoader] 2. Erase [Params] 3. Erase [Kernel] 4. Erase [FileSys] 5. Erase ALL s. Erase sector menu boot_auto boot copy eraseflash help version ** version %s ** 5.36-9-pmu-MP Command Line Mode ----------------- "help" -- for help. "menu" -- for Menu Mode rrload> View/Edit Params ---------------- 1. ui mode [cmd|menu] : %s 2. default boot cmd : %s 3. I/O load format : %s 4. I/O load port : %s 5. console port : %s Linux Settings 6. Kernel cmdline : %s 7. Device MAC : %s rrload TFTP Settings 8. Server IP (tftp) : %s 9. Server MAC (tftp) : %s a. Device IP (tftp) : %s b. Kernal Path (tftp) : %s c. FileSys Path (tftp) : %s Edit Which? new val = Store RAM [comp] to Flash ------------------------- 1. Store [Bootloader] 2. Store [Params] 3. Store [Kernel] 4. Store [FileSystem] Load [comp] from -%s- I/O --------------------------------- 1. Load [Kernel] 2. Load [FileSystem] Flash Memory Map Flash hardware: %X - %X rrload: %X - %X (max %X) rrload: %X - not loaded (max %X) rrload parameters: %X - %X (max %X) kernel: %X - %X (max %X) kernel: %X - not loaded (max %X) file system: %X - %X (max %X) file system: %X - not loaded (max %X) RAM Memory Map -------------- Hit any key to continue Flash Chip Information ---------------------- ERROR: flash chip did not respond to CFI query Flash manufacturer / device ID: %X Flash size (Mbytes): %d Command Set: %d Primary Extended table address: %x Primary Extended table version: %c.%c Top / Bottom boot flag: %d Common Flash Interface data %x = %b Flash Sector Map (%d sectors) %x = %X +-------------------------------------+ | Welcome to the | | rrload bootloader | | | | Version: v%s ***ForUpGrade*** | | Version: v%s | | PMP Version: %x | | Datecode: %s | 0400831d | Platform: DM270 | | ARM clock: %d kHz | | SDRAM clock: %d kHz | | 64Mbyte sdram | MAIN MENU --------- 1. Load [comp] from I/O port... 2. Store RAM [comp] to Flash... 3. View/Edit Params... 4. Boot Kernel/filesystem (boot_auto) 5. CmdLine Mode %c. Print memory map f. Print flash chip information r. Run Default Boot Cmd E. Erase [comp] from Flash... Default Cmd: %s Press before countdown expires to intercept. executing rrbin serial 10.1.8.226 00:0B:CD:08:30:8B 10.1.8.100 00:e0:81:10:70:cf linux.rr.dm270 fs.img.rr.dm270 +-------------------------------------+ | - rrload - ***ForUpGrade*** | | - rrload - | | version %s | | platform: DM270 | | ARM clock: %d kHz | Error - Linker script FileSysStart too small and leaves no room for storing a kernel image! %s:%d Logic Error btldr_pi.c ERROR: parse status = %d: Aborting. WARNING: downloaded component is larger than the reserved flash space. Warning: Can't overwrite existing one; Aborting Press .... Flash Write error at offset %d etherMAC--> kcmdline--> Command line overrides = %s Jumping to 0x%X Bad digit '%c' %s:%d Logic Error util.c %s:%d IP format error %s:%d MAC str format Error 0123456789ABCDEF %d.%d.%d.%d octet %s:%d Logic Error tftp.c %s:%d TFTP_DATA: Cant handle out-of-order tftp blocks %s:%d Aborting size of tftp_datagram_t = %d size of udp_hdr_t = %d size of ip_hdr_t = %d size of ether_hdr_t = %d sizefullframe = %d, full_ether_frame = %d %s:%d Bummer, has your compiler padded the full_ether_frame buffer? %s:%d Logic Error net.c num_bytes being set to zero I2C write Error.. addr : %x, data : %x I2C read Error... check %x Error: address range %X - %X not erased: %X=%x ---------------------------------------------------- Manufacturer's ID = 0x%x [ST] [SST] Device ID = 0x%x [M29W320DB] [SST39VF320] [SST39VF3201] [SST39VF3202] read_cfi_array: ERROR array too small build_sector_map: ERROR unable to read CFI array ERROR: flash chip did not respond to CFI query build_sector_map: ERROR sector map array too small %d Warning: calculated flash size doesn't match CFI query flash size Calculated flash size: %d Mbytes CFI stated flash size: %d Mbytes Programming error; flash not erased; 0x%X = %x (programming %x) Erasing %X to %X Press return to continue Erasing blocks containing addresses 0x%X to 0x%X Erase flash bad address range Erasing block %i of %i 00:e0:81:10:70:cf 10.1.8.226 00:0B:CD:08:30:8B 10.1.8.100 linux.rr.dm270 fs.img.rr.dm270 menu boot_auto rrbin serial serial -rom AT4 $ AT$!$ AT`!$ armv3 *(0K ARM/VLSI ARM 6 ARM 610 ARM 7 ARM 710 ARM 7 TDMI Atmel AT91M40xxx Samsung S3C4510B S3C4530A01 *(0K #$0K !CgE# @4 @4 0d ,0 gfff vedb : K EPIP EPIP\ K(0K *( K gfff RRaArrAa RRaArrAa -rom @0E> VUUU @lG> #(0K *(0K 0C",0 *( K * 0h gfff USBCUSBS @f * 0K *( K USBCUSBS KCOS KCOS\N= Function entered at [<%p>] from [<%p>] r%d = %08X%c insw: bad buffer alignment (0x%p, lr=0x%08lX) outsw: bad buffer alignment (0x%p, lr=0x%08lX) pG2 P @ #! pG2 P @2 @ @ c! @ #! @ c! init TERM=linux HOME=/ Calibrating delay loop... %lu.%02lu BogoMIPS init= pmp version %#lx Kernel command line: %s POSIX conformance testing by UNIFIX /dev/console Warning: unable to open an initial console. /sbin/init /etc/init /bin/init /bin/sh No init found. Try passing init= option to kernel. Linux version 2.4.19-uc1 (root@lyoung) (gcc version 2.96 20000110 (experimental)) #4 2004. 09. 11. ( ) 11:55:04 KST mtdblock ftld ftlc ftlb ftla nftld nftlc nftlb nftla ataraid/d15p ataraid/d14p ataraid/d13p ataraid/d12p ataraid/d11p ataraid/d10p ataraid/d9p ataraid/d8p ataraid/d7p ataraid/d6p ataraid/d5p ataraid/d4p ataraid/d3p ataraid/d2p ataraid/d1p ataraid/d0p jsfd apblock sbpcd gscd cm206cd aztcd sonycd cdu535 loop /dev/ /root VFS: Cannot open root device "%s" or %s Please append a correct "root=" boot option VFS: Unable to mount root fs on %s VFS: Mounted root (%s filesystem)%s. readonly /dev/root <5>VFS: Insert %s and press ENTER /dev/console <5>RAMDISK: Compressed image found at block %d <5>RAMDISK: romfs filesystem found at block %d <5>RAMDISK: Minix filesystem found at block %d <5>RAMDISK: ext2 filesystem found at block %d <5>RAMDISK: Couldn't find valid RAM disk image starting at %d. |/-\/dev/ram RAMDISK: image too big! (%d/%d blocks) <3>RAMDISK: could not allocate buffer /dev/initrd <3>RAMDISK: could not determine device size <5>RAMDISK: Loading %d blocks [%d disk%s] into ram disk... done disk #%d. Error closing the disk. disk #%d Error opening disk. Loading disk #%d... done. root floppy disk to be loaded into RAM disk /dev incomplete literal tree incomplete distance tree bad gzip magic numbers internal error, invalid method Input is encrypted Multi part input Input has invalid flags invalid compressed format (err=1) invalid compressed format (err=2) out of memory invalid compressed format (other) crc error length error <3>%s <3>RAMDISK: Couldn't allocate gzip buffer <3>RAMDISK: Couldn't allocate gzip window kcmdline--> Command line (Override): %s TMS320DM270 Development Module <7>Converting old-style param struct to taglist <4>Warning: bad configuration page, trying to continue %2d: %14s %s <3>dma: trying to allocate DMA%d <3>dma%d: freeing active DMA <3>dma%d: trying to free free DMA <3>dma: trying to free DMA%d <3>dma%d: altering DMA address while DMA active <3>dma%d: altering DMA count while DMA active <3>dma%d: altering DMA mode while DMA active <3>dma%d: trying to enable free DMA dma.c <3>dma%d: trying to disable free DMA <3>dma%d: trying to set_dma_page %3d: %10u %s , %s Err: %10lu <3>IRQ LOCK: IRQ%d is locking the system, disabled <3>IRQ: spurious interrupt %d <3>Trying to free IRQ%d <3>Trying to free free IRQ%d Reboot failed -- System halted pc : [<%08lx>] lr : [<%08lx>] %s sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Segment %s kernel user Control: %X f%d(%c): %08lx %08lx %08lx%c FPSR: %08lx FPCR: %08lx <3>ptrace: too many breakpoints ptrace_cancel_bpt: bogus nsaved: %d! <3>ptrace_cancel_bpt: weirdness Kernel data Kernel code Video RAM reserved CPU configuration botched (ID %08x), unable to continue. Processor: %s %s revision %d %s%c Architecture configuration botched (nr %d), unable to continue. Architecture: %s <4>Using compatibility code scheduled for removal in v%d.%d.%d mem= System RAM <4>Ignoring memory bank 0x%08x size %dKB <4>Ignoring unrecognised tag 0x%08x <4>Warning: bad configuration page, trying to continue Unused memory region: %08lX - %08lX (%d Kbytes) Processor : %s %s rev %d (%s) BogoMIPS : %lu.%02lu Hardware : %s Revision : %04x Serial : %08x%08x timer SYS_32 UK14_32 UK13_32 UK12_32 UND_32 UK10_32 UK9_32 UK8_32 ABT_32 UK6_32 UK5_32 UK4_32 SVC_32 IRQ_32 FIQ_32 USER_32 UK15_26 UK14_26 UK13_26 UK12_26 UK11_26 UK10_26 UK9_26 UK8_26 UK7_26 UK6_26 UK5_26 UK4_26 SVC_26 IRQ_26 FIQ_26 USER_26 interrupt address exception data abort prefetch abort %08lx: %08x Code: (%0*x) %0*x bad PC value. Stack: Backtrace: no frame pointer invalid frame pointer 0x%08x frame pointer underflow Internal error: %s: %x CPU: %d Process %s (pid: %d, stackpage=%08lx) <6>%s (%d): undefined instruction: pc=%p Oops - undefined instruction Hmm. Unexpected FIQ received, but trying to continue You may have a hardware problem... <2>Bad mode in %s handler detected: mode %s <2>Vectors: <2>Stubs: Oops bad mode <3>[%d] %s: obsolete system call %08x. branch through zero [%d] %s: arm syscall %d xchg: bad data size: pc 0x%p, ptr 0x%p, size %d traps.c <3>[%d] %s: bad data abort: code %d instr 0x%08lx unknown data abort code <2>kernel BUG at %s:%d! <2> - extra data = %p %s called, but not implemented %s:%d: bad pte %08lx. %s:%d: bad pmd %08lx. %s:%d: bad pgd %08lx. Division by zero in kernel. <2>abort() called from %p! (Please report to rmk@arm.linux.org.uk) Oops failed to kill thread <7>Relocating machine vectors to 0x%08x readb writeb Mem-info: Free swap: %6dkB %d pages of RAM %d free pages %d reserved pages %d pages shared %d pages swap cached init.c <6>Memory: %ldMB = %luMB total <5>Memory: %luKB available (%dK code, %dK data, %dK init) Freeing %s memory: %dK init %s(%d): start_code=0x%x, start_stack=0x%x) fault-common.c <1>Unable to handle kernel %s at virtual address %08lx NULL pointer dereference paging request Oops <7>%s: unhandled page fault at pc=0x%08lx, lr=0x%08lx (bad address=0x%08lx, code %d) %s %d VM: killing process %s consistent.c page permission fault section permission fault external abort on translation page domain fault section domain fault external abort on non-linefetch page translation fault section translation fault external abort on linefetch terminal exception alignment exception vector exception <1>Unhandled fault: %s (%X) at 0x%08lx Oops <7>Fixing up bad data abort at %08lx %s %i mm-armv.c DMA1 DMA2 Unrecognized DMA endpoint PP 0 set gio dir <3>schedule_timeout: wrong timeout value %lx from %p sched.c Scheduling in interrupt %-13.13s current %08lX %5lu %5d %6d %5d %5d (L-TLB) (NOTLB) free sibling task PC stack pid father child younger older UGH! (%d:%d) was on the runqueue, removing. fork.c signal_act Cannot create signal action SLAB cache files_cache Cannot create files SLAB cache fs_cache Cannot create fs_struct SLAB cache vm_area_struct vma_init: Cannot alloc vm_area_struct SLAB cache mm_struct vma_init: Cannot alloc mm_struct SLAB cache Linux personality-%ld <7>[%s:%d]: set personality to %lx %d-%d %-16s [%s] kernel fake_utsname trace defhandler_libcso defhandler_lcall7 defhandler_elf defhandler_coff <0>Kernel panic: %s <0>In interrupt handler - not syncing <0>In idle task - not syncing <0>Rebooting in %d seconds.. Tainted: %c%c Not tainted kernel BUG in header file at line %d panic.c ttyS /dev/ printk.c <0>%s <3>Aiee, inter_module_register: cannot kmalloc entry for '%s' <3>inter_module_register: duplicate im_name '%s' module.c <3>inter_module_unregister: no entry for '%s', probably caused by previous kmalloc failure <3>inter_module_unregister: no entry for '%s' <3>inter_module_put: no entry for '%s' <3>init_module: Invalid module header size. <3>A new version of the modutils is likely needed. <3>init_module: Size of initialized module exceeds size of created module. <3>init_module: mod->name out of bounds. <3>init_module: mod->syms out of bounds. <3>init_module: mod->deps out of bounds. <3>init_module: mod->init out of bounds. <3>init_module: mod->cleanup out of bounds. <3>init_module: mod->ex_table_* invalid. <3>init_module: mod->flags invalid. <3>init_module: mod->can_unload out of bounds. <3>init_module: mod->kallsyms out of bounds. <3>init_module: mod->kallsyms invalid. <3>init_module: mod->archdata out of bounds. <3>init_module: mod->archdata invalid. <3>init_module: mod->kernel_data must be zero. <3>init_module: get_mod_name failure. <3>init_module: changed module name to `%s' from `%s' <3>init_module: self-referential dependency in mod->deps. <3>init_module: found dependency that is (no longer?) a module. %8lu %4ld (deleted) (autoclean) (unused) (initializing) (uninitialized) %0*lx %s [%s] %0*lx %s task releasing itself exit.c Aiee, killing interrupt handler! Attempted to kill the idle task! Attempted to kill init! <6>note: %s[%d] exited with preempt_count %d softirq.c Attempt to kill tasklet from interrupt ksoftirqd_CPU%d spawn_ksoftirqd() failed for cpu %d PCI IO PCI mem %08lx-%08lx : %s %04lx-%04lx : %s check-region Trying to free nonexistent resource <%08lx-%08lx> reserved bug: kernel timer added twice at %p. <5>Clock: inserting leap second 23:59:60 UTC <5>Clock: deleting leap second 23:59:59 UTC uid_cache Cannot create uid taskcount SLAB cache sigqueue signals_init(): cannot create sigqueue SLAB cache <0>Restarting system. <0>System halted. <0>Power down. <0>Restarting system with command '%s'. PATH=/sbin:/usr/sbin:/bin:/usr/bin TERM=linux HOME=/ <3>kmod: failed to exec %s -s -k %s, errno = %d <3>request_module[%s]: Root fs not mounted <3>kmod: runaway modprobe loop assumed and stopped <3>request_module[%s]: fork failed, errno %d <3>request_module[%s]: waitpid(%d,...) failed, errno %d <3>%s(): keventd has not started current_is_keventd schedule_task keventd cdroms/cdrom%d bootmem.c hm, page %08lx reserved twice. <4>reserve_bootmem_core: address %08lx below node_boot_start <1>bootmem alloc of %lu bytes failed! Out of memory filemap.c Page-cache hash table entries: %d (order: %lu, %lu bytes) Failed to allocate page hash table MAP_SHARED not supported (cannot write mappings to disk) Private writable mappings not supported Allocation of tblock for %lu byte allocation from process %d failed Allocation of rblock for %lu byte allocation from process %d failed Allocation of length %lu from process %d failed munmap of non-mmaped memory by process %d (%s): %p slab.c size-%lu size-%lu(DMA) <3>kmem_create: %sForcing size word alignment - %s kmem_cache_create: couldn't create cache %s. <3>kmem_cache_destroy: Can't free all objects %p slabinfo - version: 1.1 broken %-17s %6lu %6lu %6u %4lu %4lu %4u ksize on unknown page type (index=%ld)! No swap vmscan.c kswapd Starting kswapd swap.c swap_state.c <3>Out of Memory: Killed process %d (%s). Out of memory and no killable processes... HighMem Normal page_alloc.c Free pages: %6dkB (%6dkB HighMem) Zone:%s freepages:%6lukB min:%6lukB low:%6lukB high:%6lukB ( Active: %d, inactive: %d, free: %d ) %lu*%lukB = %lukB) On node %d totalpages: %lu zone(%lu): %lu pages. BUG: wrong zone alignment, it will crash setup_mem_frac: %d open.c <3>chown_common: NULL inode <4>get_unused_fd: slot %d not NULL! <3>VFS: Close: file count is 0 Character devices: %3d %s char-major-%d %02x:%02x unknown-char %s(%d,%d) <7>init_special_inode: bogus imode (%o) <4>VFS: filp allocation failed <6>VFS: file-max limit %d reached buffer.c invalidate: dirty buffer invalidate: busy buffer <3>VFS: brelse: Trying to free free buffer <3>%s: zeroing uptodate buffer! __block_prepare_write brw_kiovec: iobuf not initialised brw_page: page not locked for I/O No block device for %s Buffer memory: %6dkB Cache memory: %6dkB Buffer-cache hash table entries: %d (order: %d, %ld bytes) Failed to allocate buffer hash table bdflush kupdated %s %s nodev <3>VFS: Busy inodes after unmount. Self-destruct in 5 seconds. Have a nice day... bdev: bdev bdev_cache Cannot create bdev_cache SLAB cache Cannot register bdev pseudo-fs Cannot create bdev pseudo-fs block_dev.c Block devices: %3d %s block-major-%d VFS: busy inodes on changed media. unknown-block %s(%d,%d) cdev_cache Cannot create cdev_cache SLAB cache <3>mem_map disagrees with %p at %08lx exec.c binfmt-%04x core pipe.c [%lu] pipe: pipefs usr/gnemul/bsd/ fcntl.c <3>kill_fasync: bad magic number in fasync_struct! fasync cache cannot create fasync slab cache locks.c Attempting to free lock with active wait queue Attempting to free lock with active block list Attempting to free lock on active lock list <3>locks_insert_block: removing duplicated lock (pid=%d %Ld-%Ld type=%d) <3>locks_delete_lock: fasync == %p <3>locks_conflict(): impossible lock type - %d <4>lease timed out %d:%s %6s %s ACCESS POSIX MANDATORY ADVISORY *NOINODE* FLOCK MSNFS FLOCK ADVISORY LEASE MANDATORY UNKNOWN UNKNOWN RW READ WRITE NONE %d %s:%ld %Ld EOF %08lx %08lx %08lx %08lx %08lx file lock cache cannot create file lock slab cache dcache.c <4>VFS: moving negative dcache entry (deleted) dentry_cache Cannot create dentry cache <6>Dentry cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate dcache hash table buffer_head Cannot create buffer head SLAB cache names_cache Cannot create names SLAB cache filp Cannot create filp SLAB cache inode.c <3>write_inode_now: no super block <6>Inode cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate inode hash table inode_cache cannot create inode slab cache attr.c <3>%s array = 0 (num = %d) free_fd_array free_fdset dnotify cache cannot create dnotify slab cache nfsd ,nodiratime ,noatime ,mand ,sync ,noexec ,nodev ,nosuid none 0 0 rootfs Can't create rootfs Can't allocate initial namespace mnt_cache Cannot create vfsmount cache Failed to allocate mount hash table Mount-cache hash table entries: %d (order: %ld, %ld bytes) Process %s:%d received signr %d and should have core dumped BINFMT_FLAT: reloc outside program 0x%x (0 - 0x%x), killing! BINFMT_FLAT: reloc addr outside text/data 0x%x code(0x%x - 0x%x) data(0x%x - 0x%x) killing BINFMT_FLAT: Unknown relocation type=%x bFLT BINFMT_FLAT: bad magic/rev (0x%x, need 0x%x) Support for ZFLAT executables is not enabled. Unable to allocate RAM for process data, errno %d Unable to read data+bss, errno %d Unable to read code+data+bss, errno %d de_put: entry %s already free! de_put: deferred delete of %s proc_iget: using deleted entry %s, count=%d proc_read_super: get root inode failed proc sysvipc driver /proc mounts root maps statm stat cmdline status environ procfs: impossible type (%d) self remove_proc_entry: %s/%s busy, count=%d Name: W (paging) T (stopped) Z (zombie) D (disk sleep) S (sleeping) R (running) State: %s Tgid: %d Pid: %d PPid: %d TracerPid: %d Uid: %d %d %d %d Gid: %d %d %d %d FDSize: %d Groups: Mem: %8lu bytes Slack: %8lu bytes Shared: %8lu bytes SigPnd: SigBlk: SigIgn: SigCgt: CapInh: %016x CapPrm: %016x CapEff: %016x %d (%s) %c %d %d %d %d %d %lu %lu %lu %lu %lu %lu %lu %ld %ld %ld %ld %ld %ld %lu %lu %ld %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %d %d %d %d %d %d %d %d %d %d-%d system:/dev/tty system:console system:vtmaster system console serial:callout serial pty:master pty:slave type:%d.%d %-20s /dev/%-8s %3d %7s %s unknown %-10s %2d tty/ldisc tty/driver tty/ldiscs tty/drivers %d.%02d %d.%02d %d.%02d %d/%d %d %lu.%02lu %lu.%02lu total: used: free: shared: buffers: cached: Mem: %8Lu %8Lu %8Lu %8Lu %8Lu %8Lu Swap: %8Lu %8Lu %8Lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapCached: %8lu kB Active: %8u kB Inactive: %8u kB HighTotal: %8lu kB HighFree: %8lu kB LowTotal: %8lu kB LowFree: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB cpu %u %u %u %lu cpu%d %u %u %u %lu page %u %u swap %u %u intr %u disk_io: (%u,%u):(%u,%u,%u,%u,%u) ctxt %u btime %lu processes %lu execdomains iomem swaps locks cmdline ioports filesystems interrupts partitions devices stat modules version meminfo uptime loadavg mounts self/mounts kmsg cpuinfo slabinfo ksyms kcore profile CORE vmlinux /ldata/young/cadenux-dm270-5th-new-0906/linux/include/linux/raid/md_k.h %s%d sd%c%c %s/c%dd%d %s/c%dd%dp%d %s/d%d %s/d%dp%d %s%c%d %s%c p%d <6>Partition check: <6> /dev/%s: <6> %s: unable to read partition table unknown partition table [EZD] [DM6:DDO] [DM6:MBR] [DM6:AUX] [PTBL] ramfs rootfs trying to free block on nonexistent device trying to free block not in datazone minix_free_block: nonexistent bitmap buffer free_block (%s:%d): bit already cleared trying to get new block from nonexistent device new_block: bit already set Bad inode number on dev %s: %ld is out of range unable to read i-node block free_inode: inode 0 or nonexistent inode free_inode: nonexistent imap in superblock free_inode: bit %lu already cleared. new_inode: bit already set minix_bmap: block<0 minix_bmap: block>big minix_bmap: block<0 minix_bmap: block>big MINIX-fs warning: remounting unchecked fs, running fsck is recommended. MINIX-fs warning: remounting fs with errors, running fsck is recommended. bad V1 i-node size bad V2 i-node size MINIX-fs: mounting unchecked file system, running fsck is recommended. MINIX-fs: mounting file system with errors, running fsck is recommended. MINIX-fs: get root inode failed MINIX-fs: bad superblock or unable to read bitmaps MINIX-fs: can't allocate map VFS: Can't find a Minix or Minix V2 filesystem on device %s. MINIX-fs: blocksize too small for device. MINIX-fs: unable to read superblock IO error syncing minix inode [%s:%08lx] minix dir.c bread in fat_access failed 2nd bread in fat_access failed FAT cache corruption inode=%ld fat_free: skipped EOF fat_free: deleting beyond EOF . .. file.c check relaxed normal strict conv binary text auto dots nocase nodots showexec dotsOK umask debug quiet blocksize FAT: blocksize option is obsolete, not supported now sys_immutable codepage MSDOS FS: Using codepage %d iocharset MSDOS FS: IO charset %s cvf_format cvf_options Directory %ld: bad FAT FAT: unable to read boot sector FAT: bogus logical sector size %d FAT: bogus cluster size %d FAT: logical sector size too small for device (logical sector size = %d) FAT: bread failed, FSINFO block (blocknr = %d) FAT: Did not find valid FSINFO signature. Found signature1 0x%x signature2 0x%x sector=%ld. none [MS-DOS FS Rel. 12,FAT %d,check=%c,conv=%c,uid=%d,gid=%d,umask=%03o%s] ,bmap [me=0x%x,cs=%d,#f=%d,fs=%d,fl=%ld,ds=%ld,de=%d,data=%ld,se=%u,ts=%u,ls=%d,rc=%ld,fc=%u] hard sector size = %d cp%d iso8859-15 FAT: get root inode failed VFS: Can't find a valid FAT filesystem on dev %s. FAT: freeing iocharset=%s EXECOMBAT dev = %s, ino = %d msdos_write_inode: unable to read i-node block Filesystem panic (dev %s). %s File system has been set read-only Invalid conversion mode - defaulting to binary. FAT bread failed in fat_clusters_flush FAT: Did not find valid FSINFO signature. Found signature1 0x%x signature2 0x%x sector=%ld. File without EOF file_cluster badly computed!!! %d <> %ld getblk failed Odd directory size Directory sread (sector 0x%x) failed FAT error plain register_cvf_format: version %d already registered CVF format %s (version id %d) successfully registered. register_cvf_format: too many formats unregister_cvf_format: format %d in use, cannot remove! CVF format %s (version id %d) successfully unregistered. unregister_cvf_format: format %d is not registered <0>FAT FS/CVF: This is a bug in cvf_version_use_count dec_cvf_format_use_count_by_version: version %d not found ??? autoload cvf_autoload CVF format %s unknown (module not loaded?) CVF detection ambiguous, please use cvf_format=xxx option COM4 COM3 COM2 COM1 LPT4 LPT3 LPT2 LPT1 AUX NUL PRN CON <4>msdos_mkdir: error=%d, attempting cleanup .. <4>MSDOS: %s/%s, get dotdot failed, ret=%d msdos true false utf8 uni_xlate posix nonumtail shortname lower win95 winnt mixed aux nul prn con lpt9 lpt8 lpt7 lpt6 lpt5 lpt4 lpt3 lpt2 lpt1 com9 com8 com7 com6 com5 com4 com3 com2 com1 namei.c %04X .. <4>vfat_rename: fs corrupted vfat Unable to load NLS charset %s: name too long nls_%s Unable to load NLS charset %s default iso8859-15 cp932 sjis cp932 euc-jp cp932 cp936 gb2312 cp936 cp949 euc-kr cp949 cp950 big5 cp950 iso8859-2 iso8859-5 iso8859-9 iso8859-13 iso8859-15 romfs: unable to read superblock VFS: Can't find a romfs filesystem on dev %s. romfs: bad initial checksum on dev %s. romfs: read error for inode 0x%x romfs <3>ipc_init_ids() failed, ipc service disabled. util.c sysvipc/msg msg.c key msqid perms cbytes qnum lspid lrpid uid gid cuid cgid stime rtime ctime %10d %10d %4o %10lu %10lu %5u %5u %5u %5u %5u %5u %10lu %10lu %10lu sysvipc/sem sem.c freeundos undo list error id=%d sem_exit undo list error id=%d key semid perms nsems uid gid cuid cgid otime ctime %10d %10d %4o %10lu %5u %5u %5u %5u %10lu %10lu sysvipc/shm shm.c SYSV%08x key shmid perms size cpid lpid nattch uid gid cuid cgid atime dtime ctime %10d %10d %4o %10u %5u %5u %5d %5u %5u %5u %5u %10lu %10lu %10lu %10d %10d %4o %21u %5u %5u %5d %5u %5u %5u %5u %10lu %10lu %10lu [%ld]%#lx unknown command event_queuemod kernel : i2c Read Error Kernel : i2c Write Error unknown commnad Kernel DD : i2c Write Error dev Addr : %x, word Addr : %x, value : %x kernel DD : i2c Read Error i2c_dm270mod i2c_dm270mode ide_startstop_t drive_cmd_intr stat : %#x, jiffies : %#x Try killing the processes [%d] stat : %#x, jiffies : %#x drive_cmd_intr end stat : %#x, jiffies : %#x set_hdd_standby_mode [%#lx] ide_startstop_t ioctl_drive_cmd_intr do nothing ioctl_hdd_standby_mode [%#lx] set_hdd_power_off [%#lx] set_lcd_power_off [%#lx] PP0 cpu off set_cpu_power_off [%#lx] kill_process [%#lx] dm270pmp_powerkey_remocon_power_timer_1st_func KEY_25 usValueRemocon : %#x dm270pmp_powerkey_remocon_power_timer_2nd_func usChkCount : %d KEY_25 usValue : %#x KEY_23 usValue : %#x dm270pmp_powerkey_power_timer_2nd_func dm270pmp_powerkey_power_3rd_timer_func start powerkey timer dm270pmp_powerkey_power_immediate_func retries : %d, jiffies : %d hddStandbySuccess %d, retries %d dm270pmp_powerkey_power_hold_immediate_func dm270pmp_powerkey_interrupt_func %#x dm270pmp_powerkey_ioctl DM270PMP_POWERKEY_IOC_REMOCON_OFF_1ST DM270PMP_POWERKEY_IOC_OFF_1ST DM270PMP_POWERKEY_IOC_OFF_2ND DM270PMP_POWERKEY_IOC_OFF_3RD DM270PMP_POWERKEY_IOC_HDD_STANDBY DM270PMP_POWERKEY_IO_HDD_STATUS stat : %#x DM270PMP_POWERKEY_IOC_POWEROFF_DISABLE DM270PMP_POWERKEY_IOC_POWEROFF_ENABLE unknown command dm270pmp_powerkey_open dm270pmp_powerkey_release powerkeymod register_chrdev fail power interrupt power battery failed powerkery ret => %d, majornum = %d pmu_goFinalize ADC 2 CHANNEL IS LOWER THAN THRESHOLD VOLTAGE!! Reprogramming the AD Reference voltage..... FAILED == hold off == no ramge adc value LOW BATTERY..!! GO TO STANDBY..!! push queue BAT_LOW add timer!! ok CRITICAL ERROR : DCUDC1 1.8V ERROR Reprogramming .... CRITICAL ERROR : DCDC1 1.5V ERROR CRITICAL ERROR : USB 3.3V ERRORN CRITICAL ERROR : USB 2.5V ERRORN PMU STATUS REGISTER : %X CRITICAL ERROR : PMU STATUS DCDC1 ERROR CRITICAL ERROR : PMU STATUS DCUDC1 ERROR CRITICAL ERROR : PMU STATUS D2REGC1 ERROR CRITICAL ERROR : PMU STATUS D3REGC1 ERROR CRITICAL ERROR : PMU STATUS LPREG1 ERROR PMU STATUS COMMUNICATION ERROR!!!!! pmu_detect open pmu_detect release pmu_detect ioctl pmu ioctl error.. PMU_GET BATTERY VALUE PMU_GET_REMOCON__STATE PMU_GET_REMOCON_HOLD_STATE PMU_IO_LED_ON. PMU_IO_LED_OFF. PMU_IO_SPEAKER_ON. PMU_IO_SPEAKER_OFF. PMU_SET_RECORD_MODE Speaker Off Remocon detected..speaker off... Remocon not detected..speaker on... app record mode is %d PMU_SET_TV_MODE app tv mode is %d unknow command register_chrdev failed EINVAL error EBUSY error Other error number interrupt pmu failed check_hold_init detect_value : %d temp : %d unknown command slidekeymod Kj KIKI OOOOO OOOOOOOOO OOOOOOO KNKKKKK OOOOOOO OKKNNNNNKKKKK OOOOOOO OKNNNNNNNKNKKKKK OOOOOOO NNNNNNNNNNNKKKKK OOOOOOO NNNNNNNNNKNKKKKK OOOOOOO NNNNNNNNKNNKKKKK OOOOOOO NNNNNNNNNNKKKKKK OOOOOOO NNNNNNNNNNNKKKKK OOOOOOO -}}}}}}}} }K,KOK }}}}}}}} NNNNNNNNNKNKKKKK OOOOOOO ONOO y||||||||w JNJO |||||||| NNNNNNNNKNNKKKKK OOOOO KKKKKKKK NNNNNNNNNNKKKKKK OOOOO NNNNNNNNNNNKKKKK OOOOOONK- JJJJ NNNNNNNNNKNKKKKK OOOOOOKK- -INJ NNNNNNNNKNNKKKKK OOOOOOOOOOOO OOOO KKNKN OOKK OOOKKKNKNKNK OOOOOOOOOOOOOOOOOOOOOOOOOOOO NKOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO NNNNNNNNNNKKKKKK NNNNNNNNNNNKKK uuuuuuuu uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu uuuuuuu }uuuuuuu uuuuuuuuuuuuuuuuuuuuuuuuu} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}} NNNNNNNNNKNKKOK |||||||||I w|||||||||||||||||||||||||||||||||||||||||||||||xxx w|||||w| |w|||w{u ||||||||||||||||||||||||| xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx NNNNNNNNKKKN zvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv K,IJ u|vvvvvv{vvvv xvvvv{vvvv |vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv szvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvz{ NNNNNNKKN ,,-O {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{vv y{{{ {{{{{{{{v{ {{{{{ |vv{{{{{{{{{{{{{{{{{{{{{{{{{{{{{ {{{{v {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{vv NNNNKN IIJ,I,KOO |}-KJ KKNK JJKKK ,KI} uwvvv{v{vv| jhhhhhh O-,-O -KKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKK KKKKKKKKKKKKKKKKKKKKKKKKKKKK JIJ, JIII ,IK- KKOK JKKK NNNNNNNNNNNNNNNNNNN NNNNNNKKKKKKNKNN NOOO NNNNNNNNNNNNNNNNNNNNNI KOOOOO KKKKKKKKKKKKKKKKKK ,J,KOOO JNNKK OOOOOOOOOOOOOOOOOOOKKK KIKKK OOOOOOOOOOOOOOOOOOOKKK ,KKO KIKJ I-I, OOOJ,I, KKOO OOOOOOOOOOOOOOOOOOOJJI,K OOKJK JJNKK OOOOOOOOOOOOOOOOKKK -IIK JNNKKK OKNK NNKKKKNN NNKKKJJ KKKKKKKKKKKKKKKKNNN NNNNN NNNNNJ NNNNNNNNNNNNNNNNN ------ IKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK--- NNNNN -KNNI-- NNNNN KKK--- NNNNNNNNNNNNNNNN ~,,KOO zzzzz zzzz zzzzz zzzzzz zzzzz zzzzzz zzzzzz zzzz zzzzzz zzzz zzzz zzzzz zzzzzz zzzzz zzzz zzzz zzzz zzzzz zzzzz zzzzz zzzzz zzzzz zzzzz zzzz zzzzz zzzzz zzzzzz zzzzzz zzzzzz zzzz zzzzz zzzzzz zzzzzz zzzz zzzzzz zzzz zzzzzz zzzz zzzz zzzzzz zzzzzz yyyyy uyyyyy yyyyy yyyyy yyyyy yyyyy uyyyyy yyyy yyyyy yyyyyy yyyy yyyyy yuyyyyy yyyyy yyyyyy yyyyy yyyy yuyyyy yyyyy yyyyy yyyyy yyyy yyyy yyyyy yyyyy {{{{{{{{ yyzyy |||{ ||||| |||| yyzxy ||||| |||| |||{ |||{ |||||} ||{uxv ||{u v{{v {{{{xyv v{{v v{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{| vyx{{ xyv| v{{{ sv{{ y{{{ v{{{ xv|y y|{{{{v {{{{{ v{{{ |{{{ {{{{ xyv{{{{ uv{{vx z{{{v yv{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{| v{{{vxuz| sv{{{v v{{{v t{{{v |vyx{{{{{xyv| v{{{v v{{{v yzxy|{{{v v{{{vyx{xy {{{{{ t{{{w v{{{vsyz|yxv{{{v {{{{v w{{{{{ v{{{v v{{v|yxv|yxv{{{v v{{{v {{{{{w vv{{v v{{v| v{{{z xv{{z |{{{{v {{{{{xyv{{{v v{{vx v{{{vsyvv{{{{{{{{{{{{{{{{{{{{{{{{{{{{t{{t{v| z{{{v uz|s v{t{vsyzysvv{{vss v{t{v wvyx{{{t{xyv| vv{{t|y sv{t{vsyzx |v{{v v{t{vyx{ y{{t{{{ v{tvwsszx vv{{v yv|yxv{t{z v{{tv w{{t{{ vv{{t|y v{{{| xv|y v{t{z {t{vv {{t{{{ v{|uv{{{v v{{t|yxv|y v{{tv xv{{vu v{t{v {{t{{xyv{{{{ uvv{vx v{t{v yv{{t{{t{{t{{t{{t{{t{{t{{t{{t{t{{v{{t| v{t{vxuz|s vt{vv v{{tv vt{vv |vyx{{t{{xyv| v{t{v vt{vv yzxy|vt{v vt{{vyx{xywt{{tw yxv{{{w z{{tvsyz| xvt{tv v{t{z {{t{{w v{t{v v{tv|yxv|yxvt{tv y|v{t{v {t{t{w v{t{v vt{v|yxv|yxvt{vv xv{vv |vt{{v {t{t{xyvvvvv|uv{{vxuzt{vvsyz{t{{v{{t{{v{{t{{v{{t{{v{{t{{{tttttt|pzvvvv szvvtzsyzyszvvvzsswzu vvvtz wvyxvvvvvxyv|pzvvvv|y szvvtzsyzxswvvvv|y vvvvv ytvvvvt vvvv{sszx ztvvz yv|yxvvvvzyxv y|vvvtzu|tv tvvvvt zvvvv|y y|vvvvwsxv|y vvvvz y|vvvvz tvvvvt vt|pzvvvv|y y|vvvvw xv|y vvvvz xvttvu|vvvvvp{ttt{x yyyyy uzttvx zvvtz yvtttttttttttttttttttttttttttttt{t{tv| zws} }uwts vty}p puxvx~p yzwy} vwu}p |tvp vtwupp }u|v| vwy} vwu}p vtwu }uwv| vwy} vttzu p}tt{tt|xxxxxxx tttvx~p yzt{vtt{tv{tt{tv{tt{tv{tt{tv{ttttttttttttttttttttttttttttttttttttt{ttttttttttttttttttttttttttttttttt{ttttttttttttttttttttttttt{ttttttttttttttttttttt{tttttttttttttttttttttttttttttttttttttttttttttttt{ttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt{tttttttttttttttttttttttttttttttttttttvtttttvtttttvttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttqtttttttttttttttttttqtqtttttttttttttttttttttttttttttttqtttttttqttttttttttqttttttqtttttttttttttttttttttttttttttttttttqtttttttttqttttttttttttttttttttttttqtttttttqttttttttttttttttttttttttttttttttttttttttttttttttttttttqttttttttttqtttttttttttttttttttttqtttttttttttttttttttttttttttttttttttttttttttttttttttttttt rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr :::::: rrrrrr %62"" "226% rrrrrr <62 rrrrrr rrrrrr &((( rrrrrr 6 0( rrrrrr rrrrrr /&& rrrrrr 21(' ***) rrrrrr -'(*****) !#$3333333$# rrrrrr )*******)( PPPPPPPL rrrrrr "5'*++*****(&(/ rrrrrr +,++*** &)0!9 rrrrrr )*,,,++** '0!9 rrrrrr '*-,,,+,*& rrrrrr '*-,,,,+ rrrrrr '+-,,,,,(-!9 rrrrrr )+-,,,,+(/#S rrrrrr "++.-,,,,)/$ rrrrrr 25*..-,,+)03 rrrrrr %1)...-,,)03 rrrrrr +-...--)03 rrrrrr :25+....-)/$ rrrrrr 0).....)-# rrrrrr +-....+)! rrrrrr 6/+....-)1 rrrrrr )-....)/$ rrrrrr 6/+5...+-! rrrrrr 7.5...) rrrrrr 60)55..+-# rrrrrr ")555..+19 rrrrrr 1)555.--# rrrrrr 2/.555.+09 rrrrrr -5555..! rrrrrr 1+5555-5$ rrrrrr 60+5555+1 6/4; rrrrrr "-5555.+! rrrrrr 75555.5$ rrrrrr )5555+ rrrrrr %0-5555) rrrrrr 655555.+! rrrrrr :2)5555.." rrrrrr "+5555-/2 rrrrrr :"+5555-0 rrrrrr -5555+0 rrrrrr -5555+1 rrrrrr -5555+1 rrrrrr .5555+1 rrrrrr 55555+1 rrrrrr -5555+1 rrrrrr -5555+1 rrrrrr !-5555+0% rrrrrr !85555-/6 rrrrrr #-5555-/2 rrrrrr $/5555-)" rrrrrr $0-55557 : rrrrrr 91+5555*1 rrrrrr !)5555-56 rrrrrr L#55555.)" rrrrrr $/-5555+ rrrrrr 91+5555,/% rrrrrr !+5555-+": rrrrrr #5.555.+1 rrrrrr 91+555.+52 rrrrrr !+555.-)1< rrrrrr $/+55..+.2 rrrrrr +55...)1 rrrrrr $/+5...++" rrrrrr ).....)06 rrrrrr $5+....-' 60'8 rrrrrr -.....*) 60'+8 rrrrrr 30+.....(5"1'*,8 rrrrrr #-+....-+)*+,,+, rrrrrr +-...-,+,,,,+8 rrrrrr 30+...-,,,,,,+)7 rrrrrr #5+..-,,,,,,* rrrrrr !++.-,,,,,*) LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLS rrrrrr ),-,,,,,),# rrrrrr 1),-,,,,,*-! rrrrrr (,-,,,,+)'1$ rrrrrr '+-,,,+,)& rrrrrr 91)*,,,++**'(1" rrrrrr )),,++*** &-1"% rrrrrr !.)+++*****' )0 2 rrrrrr $/)*+******) &.1 2 rrrrrr *(******) */1 "266% %662" rrrrrr #0(()***) /000 rrrrrr (((*) rrrrrr .'&( rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr 3$#!!! !!!#$9 rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr ooooo ololq qoliiiiioo{ ooolq rrrrrr qMBHIMq oKIJFMq l`MKJGCBBGJKNfo lJFJFN{ l````````````fl{ rrrrrr oE=C?Gl l@BC?Ho oRE?B?=CKMJ@>?@?K`{ i@?C>Ko fG?@B?=???==?ACHNf{ rrrrrr oKBHGJl lEEHGKo lM?AICAUlqqqiNBGEB?Rq lEAHCMo qM?EFAK`iif`OK?AA?BNo rrrrrr oK@IAJl lEFIAKo oK?EIAMi {fGAIG=O{ iFCICMo oH@IFFf o`HGIG>Jl rrrrrr oK@IAJl lEFIAKo {N?EICKl fFAHC?` lFCICMo oJ@IFHi iKCIE?Ko rrrrrr oK@IAJl lFFIAKo iBEIGCi U@FIBJo iFCIBMo oK@IFHi oKCII?N{ rrrrrr oK@IAJl lFFIAKo {MBII@R qMBII?R lFCICMo oJ@IFHi iGEIF?f rrrrrr oK@IAJl lEFIAKo iCFIFGl f@FIBKo iFCICMo oK@IFHi RCII?Mq rrrrrr oK@IAJl lEFIAKo `?IIBMq oKGIGCi lFCICMo oK@IFHi lCIIE@l rrrrrr oK@IAJl lFFIAKo {NBII@` NAIE?U iFCIBMo oK@IFHi {MBII?` rrrrrr oK@IAJo oFFIAKo qKAII?i RAIH>N{ lFCICMo oJ@IFHi f=HICN rrrrrr oK@IFH`iiiiiiiiiil`EEIAKo oBFIGFl fFEH?Mq iFCICMo oK@IFHi i=IIFKq rrrrrr oK@IIE@??????????=@IIIAKo o@FIAJo iGEI?Mq lFCICMo oK@IFHi lBFIIAq rrrrrr oK@IEHMNNNNNNNNNNNMEEIAKo o@FIAHo iFEI?Kq lFCIBMo oK@IFHi lGGIIAq rrrrrr oK@IGJi {{{{{{{{{ iFFIAKo o@FIAJl iFEI?Mo iFCICMo oJ@IFHi lAGIICq rrrrrr oK@IAJl oFFIAKo o@FIAHo fFEI?Mq lFCICMo oK@IFHi i?EIFIq rrrrrr oK@IAJl lFFIAKo qFGIF@i `FEH>M{ iECICMo oK@IFHi f=HIAM{ rrrrrr oK@IAJl lFFIAKo qMAII?f NAII?O lFCIBMo oK@IFHi U?II@R rrrrrr oK@IAJl lFFIAKo R@II@R qMAIF@` iFCICMo oJ@IFHi qKAII>f rrrrrr oK@IAJl lEFIAKo f?IIAKo iIFICFl lFCICMo oK@IFHi f@IIAEo rrrrrr oK@IAJl lEFIAKo oJGIE@f RBEI@Nq iECICMo oK@IFHi qMAII>R rrrrrr oK@IAJl lFFIAKo U@IIBKq lFAIGBf lFCIBMo oK@IFHi {OBIIBHo rrrrrr oK@IAJl lFFIAKo oJCII@R qM@II?N{ iFCICMo oJ@IFHi {U@FIG?f rrrrrr oK@IAJl lEFIAKo fCGHFB`{ qN>EI@Jl lFCICMo oK@IFEi oNBFIG?U rrrrrr oK@IAJl lEFIAKo `?AHF@Nl {fM?FI@Hi lACIGFUq oJ@IEAOo {oiUK@FI@B` rrrrrr oK@IAJl lFFIAKo fI?FF@HN`i`MG@FG?Ml qM?FEGFMMMMMMMMMMMK`qU>GEFGKMMMKE?BA??Ni rrrrrr oJ>GBHo lCCG@Ko oREAG@?B@??BGCKfq oNBAGC>>>>>>>>>>==Ny{RFCGA?>>>?@CHM`i{ rrrrrr `ORR` {UOROf qiUOMMMMMO`lq qqqqqqqqqqqqqqqq{ qqqqqqqqqqqq{ rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr :%%%%%%%%%%%%%%%%%%%% rrrrrr %15//////55555...,,,,* rrrrrr 6/&++))('' rrrrrr 60).--,++**)(((( rrrrrr 60).-,++**) rrrrrr #!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ": rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr ~~~~~~~~~ rrrrrr rddddddddhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh~ rrrrrr sQQTTTTTTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTTTTTTTTTTTTTTTTTTTTTTTTQd~ rrrrrr ~dTdgggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggaWWWWWWWWWWWWWWWWWWWWWdQk rrrrrr hQgppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppe_____________________^dQn rrrrrr nQdmu}}|||}zspt|}||}{ss{}||||||||||||||||||||||||||||||||||||||||}|xpeV]]]]]]]]]]]]]]]]]]\^bTTs rrrrrr rQTmv vmV]]]]]]]]]]]]]]]]]]]]^WTd~ rrrrrr sTTkt {psz smV]]]]]]]]]]]]]]]]]]]]^aQk rrrrrr ~hQgp zpp{ pjV]]]]]]]]]]]]]]]]]]]^ZdQn rrrrrr hQdp{ xuvuvvuvux pZ]]]]]]]]]]]]]]]]]]]]^XTTr rrrrrr nQdmv qpmpmpmpmq vm]]]]]]]]]]]]]]]]]]]]]^bQds rrrrrr rTTjt vpt} umppppmu tj]]]]]]]]]]]]]]]]]]]]]]aQh rrrrrr sTTgsz xpsy zppppppy sjV]]]]]]]]]]]]]]]]]]]^\dQn rrrrrr dTgp xpmpmv {pc]]]]]]]]]]]]]]]]]]]]^YTQr rrrrrr kQdmv pppp| vmc]]]]]]]]]]]]]]]]]]]]^bQds rrrrrr nQTmu smV]]]]]]]]]]]]]]]]]]]]^WQh~ rrrrrr sQTjs pjV]]]]]]]]]]]]]]]]]]]]]dQk rrrrrr ~dTgs xpeV]]]]]]]]]]]]]]]]]]]^YTTn rrrrrr hQgpv tmV]]]]]]]]]]]]]]]]]]]]^bTTr rrrrrr nQdms xsjV]]]]]]]]]]]]]]]]]]]]^WTh~ rrrrrr nQTepsx xsm\]]]]]]]]]]]]]]]]]]]]]]dQh rrrrrr sTQbepstttttspsttttttpssttttttttttttttttttttttttttttttttttspm[V]]]]]]]]]]]]]]]]]]]]^XTQn rrrrrr ~hQTXZjmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmme^V^^^^^^^^^^^^^^^^^^^^^YdQds rrrrrr rTQTdaaaaaaaaaaaaaaaaaaaaaWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWbbbbbbbbbbbbbbbbbWdQQn rrrrrr rhTQQQQQQQQQQQQQQQQQQQQQQQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTTTTTTTTTTTTTTTTTTTTTTTTQQTn rrrrrr ~rkkkkkkkkkkkkkkkkkkkkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhdddddddddddddddddhkr rrrrrr ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sssssssssssssssss~ rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrr rrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}} }}}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} bEC@SRRRPPRRRRBEb }}}}}} bEU::;;;:;:::::999888766@Eb }}}}}} EBP9;<<<<<<<<<<<<<<<;;;;;::::::988765:@EM }}}}}} 1KSQPPPQPPPP<<<<<<<<<;;;;;::::::9999888676@ }}}}}} gMI<8QQQQQQPPPP<8QQQQQQPPPP<<<<<<<<<;;;;;::::::99998888876 }}}}}} GQ9QRQQQQQQPPPP<<<<<;;;;;:::::9::999988888778$ }}}}}} ObR;QSRRQQQQQQPP<<<<<;;::::)=:999888888988888777675 }}}}}} W:RSRRRRQQQQQP;;<<_FJ }}}}}} eeeeede }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} tvvtz }}}}}} vjjjjl rkjjjjjjjjjjjjlqz }}}}}} tjjjjj tjjjjjjjjjjjjjjjjjr tmmnmz ymnmmv }}}}}} tjjjjj ljjjjlxzzzzzrkjjjjjt jjjjjt tjjjjn }}}}}} tjjjjj {jjjjjx mjjjjj~ jjjjjt tjjjjn }}}}}} tjjjjj zjjjjjz {jjjjjr jjjjjt tjjjjn }}}}}} tjjjjj zjjjjjz njjjjn jjjjjt tjjjjn }}}}}} tjjjjj ztttttty~ ztttt vvvt vtttv zjjjjjz tjjjjk ztttttttx~ jjjjjt tjjjjn {vtttttv~ z{{z{xttttvtvv {ttttz }}}}}} tjjjjj tkjjjjjjjjjn{ njjjjp rjjjjl xjjjjjz zjjjjjz qjjjjl vkjjjjjjjjjjn{ {kjjjjjjjjjlkjjjjjjjjjk{ {njjjjjjjjjn~ njjjjjjjjjjjjjjx mjjjjn }}}}}} tjjjjj ~mjjjjjjjjjjjjkx pjjjjj ljjjjjz pjjjjj zjjjjjz ljjjjp rjjjjjjkjjjjjjk{ yjjjjjjjjjjjjjjjjjjjjjjx xjjjjjjjjjjjjk{ jjjjjjjjjjjjjjjm {jjjjjq }}}}}} tjjjjj mjjjjjp~ vkjjjjj{ xjjjjjx {jjjjjjr jjjjjp zjjjjjz vjjjjjx zjjjjjmx ~tjjjjjn zzjjjjjqzz{{zqjjjjmzz{ {kjjjjkx tjjjjjk jjjjjjjp{ rjjjjj{ qjjjjj{ }}}}}} tjjjjj rjjjjjv {kjjjjl jjjjjp tjjjjjjl yjjjjjx zjjjjjz vjjjjjq pjjjjk qjjjjj~ jjjjjt tjjjjn njjjjj{ xjjjjjq jjjjjjn ~jjjjjq kjjjjm }}}}}} tjjjjj ~jjjjjp vjjjjjv pjjjjj mjjjjjjj~ qjjjjj zjjjjjmnnnnnnkjjjjjq kjjjjr zjjjjjz jjjjjt tjjjjn zjjjjjt pjjjjj~ jjjjjm njjjjk xjjjjjx }}}}}} tjjjjj vjjjjj~ ljjjjm xjjjjjy jjjjjjjjv kjjjjp zjjjjjjjjjjjjjjjjjjt ljjjjy zjjjjjz jjjjjt tjjjjn qjjjjk {jjjjjt jjjjjt xjjjjjx njjjjk }}}}}} tjjjjj njjjjm tjjjjj~ jjjjjq xjjjjjjjjp yjjjjjv zjjjjjqttttttqkjjjjjm ~{z{{ pjjjjjz jjjjjt tjjjjn ljjjjp ljjjjn jjjjjt kjjjjn ~jjjjjq }}}}}} tjjjjj jjjjjr zjjjjjz pjjjjk pjjjjjjjjj qjjjjj~ zjjjjjz tjjjjjn {xrljjjjjjz jjjjjt tjjjjn jjjjjt qjjjjj jjjjjt qjjjjj~ rjjjjj{ }}}}}} tjjjjj jjjjjt jjjjjv xjjjjjykjjjjjjjjjykjjjjm zjjjjjz tjjjjjx ~vpljjjjjjjjjjjz jjjjjt tjjjjn zjjjjjjjjjjjjjjjjjjj jjjjjt {jjjjjr ljjjjm }}}}}} tjjjjj jjjjjt jjjjjt jjjjjljjjjjkjjjjljjjjjv zjjjjjz ljjjjn qjjjjjjjjjkjjjjjz jjjjjt tjjjjn zjjjjjjjjjjjjjjjjjjj jjjjjt mjjjjkyjjjjjx }}}}}} tjjjjj jjjjjt jjjjjt pjjjjjjjjjkrjjjjjjjjjj~ zjjjjjz rjjjjj kjjjjjkrxz zjjjjjz jjjjjt tjjjjn zjjjjjvzzzzzzzzzzzzz jjjjjt xjjjjjkjjjjk }}}}}} tjjjjj jjjjjt zjjjjjz xjjjjjjjjjqzjjjjjjjjjm zjjjjjz tjjjjj qjjjjjq zjjjjjz jjjjjt tjjjjn jjjjjv jjjjjt kjjjjjjjjjq }}}}}} tjjjjj mjjjjn xjjjjj{ jjjjjjjjjx kjjjjjjjjv zjjjjjz tjjjjj kjjjjn zjjjjjz jjjjjt tjjjjn jjjjjq z{{z jjjjjt qjjjjjjjjj{ }}}}}} tjjjjj rjjjjj njjjjk pjjjjjjjj pjjjjjjjj~ zjjjjjz pjjjjk jjjjjt zjjjjjz jjjjjt tjjjjn pjjjjk pjjjjv jjjjjt {jjjjjjjjn }}}}}} tjjjjj zjjjjjt zjjjjjr xjjjjjjjm xjjjjjjjm zjjjjjz ~jjjjjq jjjjjt yjjjjjz jjjjjt tjjjjn xjjjjjx zjjjjjt jjjjjt mjjjjjjjx }}}}}} tjjjjj njjjjj{ ljjjjk~ jjjjjjjt ~jjjjjjjv zjjjjjy mjjjjjz jjjjjq {kjjjjjz jjjjjt tjjjjn ljjjjk~ ljjjjjz jjjjjt xjjjjjjk }}}}}} zjjjjjr {kjjjjkx ~mjjjjjv njjjjjj{ mjjjjjj~ kjjjjn{ ~xljjjjjr pjjjjjv xkjjjjjjt ljjjjp tjjjjj yjjjjjm{ zmjjjjjr jjjjjt kjjjjjr }}}}}} ljjjjjjjjjjjjjjjjkz xjjjjjjlnjjjjjjq vjjjjjk rjjjjjm rjjjjjjjjjjjjjjjjjjq {jjjjjjlnjjjjjjjjjjl{ vjjjjjptx {jjjjjltv~ rjjjjjjmjjjjjjn jjjjjt pjjjjj~ }}}}}} ykjjjjjjjjjjjjjjjjz zljjjjjjjjjjkv ~kjjjjr ~kjjjjy njjjjjjjjjjjjjjjpz ykjjjjjjjjjjjjjjjjjv ~jjjjjjjjv mjjjjjjjp vkjjjjjjjjjjt kjjjjt ljjjjn }}}}}} {zzzzzzzzzzzzzz~ yqnnnnnnpv {ppqr yqprx ~zzzzzzzzzzzz{ xqnnnnnnqx zzzzzz {pnnnnnp~ rnnnnnnz vpnnnnnpv~ ypqrp~ xjjjjjx }}}}}} ljjjjk }}}}}} qjjjjjt }}}}}} zljjjjjjjm }}}}}} xjjjjjjlr }}}}}} {zzzz{ }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}} }}}}}}} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}Cadenux, LLC Copyright (C) 2002 DM270 Frame Buffer Driver default framebuffer <4>dm270_fb_init: Registration of fb0 failed! status=%d <4>dm270_fb_init: Registration of fb1 failed! status=%d <4>dm270_fb_init: Registration of fb2 failed! status=%d <4>dm270_fb_init: Registration of fb3 failed! status=%d /dev/fb0: SDRAM 0x%08x-0x%08x and 0x%08x-0x%08x /dev/fb1: SDRAM 0x%08x-0x%08x /dev/fb2: SDRAM 0x%08x-0x%08x /dev/fb3: SDRAM 0x%08x-0x%08x width : %#x, height %#x , ptr %#x draw hold draw sdownimg draw lowbattery draw splash pmp_initial_draw value : %d , i2cData.value : %d <3>init_module: Base reference position (%d,%d) is out of range EEPROM value : %d initial_lowbattery Hold state : hold image draw REGION CODE : %d dm270pmp_pmplock_open dm270pmp_pmplock_read dm270pmp_pmplock_write runFlag : %d, timeout : %ld ioctl DM270PMP_PMPLOCK_IOCSETTIMEOUT :%ld unknown command dm270pmp_pmplock_release pmplockmod ret => %d, majornum = %d putkey : %d,%d slidekey hold matrixkeymod dm270pmp matrixkey init ret => %d, majornum = %d col0 interrupte col0 failed col1 interrupte col1 failed col2 interrupte col2 failed usbdevicemod usbdevice interrupt usbdevice failed ERROR: flash chip didn't respond CFI query Bad digit '%c' Programming error; flash not erased; 0x%X = %x (programming %x) Error: address range %X - %X not erased: %X=%x urandom random full zero port null kmem unable to get major %d for memory devs NULL tty <4>Warning: bad magic number for tty struct (%s) in %s <4>Warning: null TTY for (%s) in %s <4>Warning: dev (%s) tty->count(%d) != #fd's(%d) in %s tty-ldisc-%d Couldn't open N_TTY ldisc for %s --- error %d. <4>tty_check_change: tty->pgrp <= 0! do_tty_hangup <3>do_tty_hangup: N_TTY open: error %d tty_read tty_write <6>init_dev: ldisc open failed, clearing slot %d release_dev <7>release_dev: bad idx when trying to free (%s) <7>release_dev: driver.table[%d] not tty for (%s) <7>release_dev: driver.termios[%d] not termios for (%s) <7>release_dev: driver.termios_locked[%d] not termios_locked for (%s) <7>release_dev: other->table[%d] not o_tty for (%s) <7>release_dev: other->termios[%d] not o_termios for (%s) <7>release_dev: other->termios_locked[%d] not o_termios_locked for (%s) <7>release_dev: bad pty pointers <4>release_dev: %s: read/write wait queue active! <4>release_dev: bad pty slave count (%d) for %s <4>release_dev: bad tty->count (%d) for %s tty_open <4>tty_io.c: process %d (%s) used obsolete /dev/%s - update software to use /dev/ttyS%d tty_poll tty_fasync tty_ioctl <4>Use of setserial/setrocket to set SPD_* flags is deprecated /dev/tty Couldn't register /dev/tty driver /dev/console Couldn't register /dev/console driver /dev/vc/0 Couldn't register /dev/tty0 driver %s: %d input overrun(s) %s: unknown flag %d n_tty_read_chan: called with read_buf == NULL?!? read_chan: tty->pgrp <= 0! n_tty <4>Warning?!? termios_locked is NULL. master pty_close: count = %d!! pty_ioctl called with NULL tty! pty_master pty_slave ttyp Couldn't register pty driver Couldn't register pty slave driver head %3i %s char-major-%d-%d misc unable to get major %d for misc devices <5>get_random_bytes called before random driver initialization unable to get major %d for vcs device [%d;%dR [?6c [M%c%c%c con_write: tty %d not allocated vc/%d Couldn't register console driver Console: %s %s %dx%d colour mono Console: switching consoles %d-%d to %s %s %dx%d to %s unblank_screen: tty %d not allocated ?? <4>selection: kmalloc() failed <3>keyboard.c: do_lowercase was called - impossible <3>do_fn called with value=%d 0123456789+-*/ ,.?()# pqrstuvwxylSRQMnnmPQS BDCA DM270 XR16850 ST16654 16C950/954 Startech TI16750 ST16650V2 ST16650 cirrus 16550A 16550 16450 8250 unknown rs_stop rs_start serial serial shutdown: request_irq: error %d Couldn't reacquire IRQ. rs_put_char rs_flush_chars rs_write rs_write_room rs_chars_in_buffer rs_flush_buffer rs_send_char serial(set) rs_break rs_ioctl TIOCSER?WILD ioctl obsolete, ignored. rs_close rs_close: bad serial port count; tty->count is 1, state->count is %d rs_close: bad serial port count for ttys%d: %d rs_wait_until_sent rs_hangup rs_open ttyS Couldn't register serial driver Couldn't register callout driver <6>ttyS%02d at 0x%p (irq = %d) request list leak! blk_cleanup_queue: leaked requests (%d) <3>drive_stat_acct: cmd not R/W? ll_rw_blk.c elevator returned crap (%d) <6>attempt to access beyond end of device <6>%s: rw=%d, want=%ld, limit=%d <3>generic_make_request: Trying to access nonexistent block-device %s (%ld) <5>ll_rw_block: device %s: only %d-char blocks implemented (%u) <5>Can't write to read-only device %s end_request: I/O error, dev %s (%s), sector %lu end_request: buffer-list destroyed blkdev_requests Can't create request pool slab cache major minor #blocks name %4d %4d %10d %s Blkmem Erase of sector at pos %lx of arena %d (address %p) Write of %lu bytes at pos %lu (data at %p) Blkmem: request list destroyed Blkmem: block not locked <3>Blkmem: bad access: block=%ld, count=%ld (pos=%lx, len=%lx) <3>Blkmem: bad command: %d arena open of %d failed! Blkmem copyright 1998,1999 D. Jeff Dionne Blkmem copyright 1998 Kenneth Albanowski Blkmem %d disk images: %d: %lX-%lX [VIRTUAL %lX-%lX] (%s) <3>Blkmem: Unable to get major %d <3>Blkmem: unregister of device failed ramdisk <6>RAMDISK: bad command: %d RAMDISK: wrong blocksize %d, reverting to defaults RAMDISK: Could not get major %d RAMDISK driver initialized: %d RAM disks of %dK size %d blocksize <3>loop: transfer error block %ld loop.c <3>loop: unknown command (%d) loop%d loop: missing bh <4>lo_ioctl: pseudo-major != %d <4>lo_open: pseudo-major != %d <4>lo_release: pseudo-major != %d <4>loop: invalid max_loop (must be between 1 and 256), using default (8) loop <4>Unable to get major number %d for loop device <6>loop: loaded (max %d devices) <3>loop: ran out of memory <4>loop: cannot unregister blkdev !"89XYZ[ dm270pmp_hddoff_timeout KODAK ATA_FLASH Hitachi CV SunDisk SDCFB HAGIWARA HPC LEXAR ATA_FLASH ATA_FLASH ide: Assuming %dMHz system bus speed for PIO modes%s ; override with idebus=xx %s: ide_set_handler: handler not null; old=%p, new=%p %s: ATAPI reset complete %s: ATAPI reset timed-out, status=0x%02x %s: reset timed-out, status=0x%02x %s: reset: success master: passed formatter device error sector buffer error ECC circuitry error controlling MPU error error (0x%02x?) ; slave: failed %s: %s: status=0x%02x Busy DriveReady DeviceFault SeekComplete DataRequest CorrectedError Index Error %s: %s: error=0x%02x DriveStatusError BadCRC BadSector UncorrectableError SectorIdNotFound TrackZeroNotFound AddrMarkNotFound , LBAsect=%llu, high=%d, low=%d , LBAsect=%ld , CHS=%d/%d/%d , sector=%ld drive_cmd_intr : dm270pmp_ide_cmd is WIN_STANDBYNOW1 drive_cmd %s: bad special flag: 0x%02x status timeout status error %s: bad device number: %s %s%c: bad access: block=%ld, count=%ld %s: drive not ready for command %s: media type %d not supported ide_set_handler: timer already active %s: Huh? nuking plugged queue %s: timeout waiting for DMA ide_timer_expiry: hwgroup->drive was NULL %s: ide_timer_expiry: hwgroup->busy was 0 ?? %s: lost interrupt irq timeout %s%s: unexpected interrupt, status=0x%02x, count=%ld %s: ide_intr: hwgroup->busy was 0 ?? %s: ide_intr: huh? expected NULL handler on exit ide-disk ide-cd ide-tape ide-floppy %s: driver not present capacity %s: channel busy io_32bit keepsettings nice1 pio_mode slow unmaskirq using_dma ide_scsi init_speed current_speed number %s: ide_set_handler: handler not null; %p 0123456789 0123456789abcdef idebus ide_setup: %s ide=nodma IDE: Prevented DMA none noprobe nowerr cdrom serialize autotune noautotune swapdata bswap flash remap noremap scsi ide- -- BAD LAST LUN! Expected value from 0 to 7 -- USE "ide%d=serialize" INSTEAD -- BAD BUS SPEED! Expected value from 20 to 66 reset ata66 minus8 minus9 minus10 four qd65xx ht6560b cmd640_vlb dtc2278 umc8672 ali14xx dc4030 -- SUPPORT NOT CONFIGURED IN THIS KERNEL -- BAD OPTION -- NOT SUPPORTED ON ide%d dm270pmp_hddoff_timer init <3>%s: does not support hotswap of device class ! flushing ide devices: <6>Uniform Multi-Platform E-IDE driver Revision: 6.31 UDMA 7 UDMA 6 UDMA 5 UDMA 4 UDMA 3 UDMA 2 UDMA 1 UDMA 0 MW DMA 2 MW DMA 1 MW DMA 0 SW DMA 2 SW DMA 1 SW DMA 0 PIO 4 PIO 3 PIO 2 PIO 1 PIO 0 PIO SLOW XFER ERROR scsi disk optical cdrom tape floppy ??????? ide_dma_read ide_dma_write ide_dma_begin ide_dma_end: ide_dma_check ide_dma_on ide_dma_off ide_dma_off_quietly ide_dma_test_irq ide_dma_bad_drive ide_dma_good_drive ide_dma_verbose ide_dma_retune ide_dma_lostirq ide_dma_timeout unknown %s: CHECK for good STATUS %s: Speed warnings UDMA 3/4/5 is not functional. set_drive_speed_status <3>%s: no DRQ after issuing %s MULTWRITE WRITE set_multmode set_geometry_intr recal_intr task_no_data_intr task_in_intr task_mulin_intr task_out_intr task_mulout_intr %s: %s Multimode Write multcount is not set ide_taskfile_ioctl %s: %s Multimode Read failure multcount is not set No space for DM270 IDE driver in ide_hwifs[]. Not enabled. ES0,ES1,ES2 ide irq set ES0,ES1,ES2 IDE GIO SET DM270 IDE configured as device %i proc_ide: error: %s: '%s' /proc/ide/%s/config: channel(s) busy, cannot write not a PCI device expected 'R' or 'P' bad/missing register number missing ':' bad data, 2/4/8 digits required expected whitespace after data parse error (none) %s version %s (none) generic cmd640 dtc2278 ali14xx qd65xx umc8672 ht6560b pdc4030 rz1000 trm290 cmd646 cy82c693 4drives mac-io (unknown) %04x%c name value min max mode ---- ----- --- --- ---- %-24s %-16d %-16s write-only %-16d%-16d proc_ide_write_settings(): parse error %llu physical %d/%d/%d logical %d/%d/%d %.40s disk cdrom tape floppy UNKNOWN settings model media identify driver ide%d/%s mate config channel drivers ide/drivers <4>(ide-probe::do_identify) Out of memory. %s: drive->id->word156 == 0x%04x E X A B Y T E N E S T %s: %s, ATAPI CD-ROM oppy poyp cdrom or floppy?, assuming FLOPPY CD/DVD-ROM TAPE OPTICAL UNKNOWN (type %d) drive ATA DISK drive %s: probing with STATUS(0x%02x) instead of ALTSTATUS(0x%02x) %s: IRQ probe failed (0x%lx) IDE: waiting for drives to settle... %s: no response (status = 0x%02x), resetting drive %s: no response (status = 0x%02x) %s: enabling %s -- failed (timeout) failed (status = 0x%02x) success %s: non-IDE drive, CHS=%d/%d/%d %s: ATAPI cdrom (?) %s: ERROR, PORTS ALREADY IN USE %s: ports already in use, skipping probe %s: reset %s: potential irq problem with %s and %s %s at 0x%03x-0x%03x,0x%03x on irq %d (%sed with %s) shar serializ host%d/bus%d/target%d/lun%d <4>(ide::init_gendisk) Out of memory %s: DISABLED, NO IRQ %s: UNABLE TO GET MAJOR NUMBER %d %s: Disabled unable to get IRQ %d. %s: probed IRQ %d and default IRQ %d failed. %s: probed IRQ %d failed, using default. [remap +63] [remap 0->1] %s%s [%d/%d/%d] 48-bit Drive: %llu read_intr %s: write_intr error1: nr_sectors=%ld, stat=0x%02x write_intr multwrite_intr <3>%s: no DRQ after issuing %s MULTWRITE WRITE <3>%s: bad command: %d <6>%s: Write Cache FAILED Flushing! %s: setmax_ext LBA %llu, native %llu %s: setmax LBA %lu, native %lu <3>%s: bad special flag: 0x%02x (none) %04x%c smart_thresholds smart_values geometry cache bios_cyl bios_head bios_sect address bswap multcount nowerr breada_readahead file_readahead max_kb_per_request wcache acoustic failures max_failures <6>%s: %ld sectors (%ld MB) w/%dKiB Cache , CHS=%d/%d/%d ide-disk 1.12 <3>ide-disk: %s: Failed to register the driver with ide.c <3>%s: INVALID GEOMETRY: %d PHYSICAL HEADS? <3>%s: cleanup_module() called while still busy Enclosure Unknown Communications Medium Changer Optical Device Scanner CD-ROM WORM Processor Printer Sequential-Access Direct-Access <6>scsi_logging_setup : usage scsi_logging_level=n (n should be 0 or non-zero) No device passed to scsi_allocate_request(). No device passed to scsi_allocate_device(). Invalid or not present host. <4>scsi_build_commandblocks: want=%d, space for=%d blocks Attached devices: %s none scsi dump add-single-device <6>scsi singledevice %d %d %d %d remove-single-device <3>scsi: Failure to register low-level scsi driver <3>scsi: register failed. <6>scsi%d : %s <3>SCSI device not inactive - rq_status=%d, target=%d, pid=%ld, state=%d, owner=%d. <3>Device busy??? <3>Attached usage count = %d <6>scsi : %d host%s left. <6>SCSI subsystem driver Revision: 1.00 <3>cannot init /proc/scsi scsi/scsi <3>cannot init /proc/scsi/scsi <6>scsi: host order: %s Attempt to delete wrong device scsi: out of memory in scsi_register. Too many extra bytes requested <3>scsi: out of memory(2) in scsi_register. Device already registered SCSI internal ioctl failed, no memory SCSI device (ioctl) reports ILLEGAL REQUEST. <6>Device not ready. Make sure there is a disc in the drive. SCSI error: host %d id %d lun %d return code = %x Sense class %x, sense error %x, extended sense %x UNKNOWN 0x%02x %02x 0x%0x Info fld=0x%x (nonstd) FMK EOM ILI Current Deferred Invalid %s%s: sns = %2x %2x ASC=%2x ASCQ=%2x Non-extended sense class %d code 0x%0x Raw sense data: %02x %02x scsi%d : destination target %d, lun %d command = Hostbyte=0x%02x Driverbyte=0x%02x The driver does not yet support the proc-fs <3>Unable to proc_mkdir in scsi.c/build_proc_dir_entries Not enough memory to register SCSI HBA in /proc/scsi ! Host: scsi%d Channel: %02d Id: %02d Lun: %02d Vendor: Model: Rev: Type: %s Unknown ANSI SCSI revision: %02x CCS $Header: /home/cvs/linux/drivers/scsi/scsi_error.c,v 1.1.1.1 2004/06/13 13:27:28 young Exp $ Error handler thread not present at %p %p %s %d scsi_error.c scsi: trying to call schedule() in interrupt, file %s, line %d. Missing scsi error handler thread cannot allocate scsi_result in scsi_request_sense. scsi%d (%d,%d,%d) : RESERVATION CONFLICT <6>scsi: device set offline - not ready or command retry failed after bus reset: host %d channel %d id %d lun %d <6>scsi: device set offline - not ready or command retry failed after host reset: host %d channel %d id %d lun %d <6>scsi: device set offline - command error recover failed: host %d channel %d id %d lun %d scsi_unjam_host: Miscount of number of failed commands. scsi_eh_%d SCSI host %d abort (pid %ld) timed out - resetting SCSI host %d channel %d reset (pid %ld) timed out - trying harder SCSI host %d reset (pid %ld) timed out - trying to shake it loose SCSI host %d reset (pid %ld) timed out again - probably an unrecoverable SCSI bus or device hang. scsi%d: device driver called scsi_done() for a synchronous reset. scsi%d : channel %d target %d lun %d request sense failed, performing reset. Internal error %s %d scsi_obsolete.c scsi%d (%d,%d,%d) : RESERVATION CONFLICT Internal error %s %d status byte = %d scsi: unsupported message byte %d received scsi%d channel %d : resetting for second half of retries. Internal error in file %s, line %d. Stale command on %d %d:%d appears to have died when the bus was reset scsi : aborting command due to timeout : pid %lu, scsi%d, channel %d, id %d, lun %d SCSI bus is being reset for host %d channel %d. $Header: /home/cvs/linux/drivers/scsi/scsi_queue.c,v 1.1.1.1 2004/06/13 13:27:30 young Exp $ I/O error: dev %s, sector %lu scsi_end_request: buffer-list destroyed <6>Device %s not ready. scsi%d: ERROR on channel %d, id %d, lun %d, CDB: SCSI %s error : host %d channel %d id %d lun %d return code = %x device Missing device Unable to find device associated with request Should not have leftover blocks dma_free_sectors:%d use_sg:%d i:%d request_bufflen:%d [%d] len:%d addr:%p bounce:%p Total %d sectors consumed DMA pool exhausted I believe this is dead code. If we hit this, I was wrong Warning - running *really* short on DMA buffers Incorrect number of segments after building list Warning - running low on DMA memory scsi_free:Bad memory alignment scsi_free:Trying to free unused memory scsi_free:Bad offset SCSI DMA pool memory leak %d %d resize_dma_pool: unknown device type %d scsi::resize_dma_pool: WARNING, dma_sectors=%u, wanted=%u, scaling WARNING, not enough memory, pool not expanded scsi::init_module: failed, out of memory DF600 DF500 DF400 SAN DataDirector CentricStor AuSaV1S2 C1557A MSA1000 Adaptec 5400S AACRAID ADAPTEC NetRAID-4M PERCRAID RocketStor 2000 RocketStor 500S Zzyzx G8324 CNSi G7324 CNSI CRA-7280 SYMMETRIX PV530F PSEUDO DEVICE . PV660F PSEUDO PV660F DELL DISK RAID MegaRAID CDROM TOSHIBA J.86 jaz 1GB iomega PD-1 MATSHITA PD-1 ODX654P CR3500 LOGICAL VOLUME COMPAQ HSG80 Fastness Crypto nCipher IPUBJD CANON MD21/S2 ESDI EMULEX CD-ROM DRM-604X CD-ROM DRM-602X CD-ROM DRM-600 PIONEER MJ-5.16S MJ-4.8S NAKAMICH CDC-4X REGAL MBR-7.4 MBR-7 4110 MICROP 3.10 CDX7405 LASOUND I325VM Floptical F*8I INSITE Io20S *F IOMEGA CD-ROM CDU-8001 5.61 ScanMaker II MICROTEK ACROSS VM3530+ Scorpio RELISYS 6119 CD-R CR-2201CS MITSUMI 1.0c CRW6416S CRW8424S CDR102 1.00 CDR100 YAMAHA OPEN- A6189B A6189A A6188A C2500A C1790A 3226 C1750A 6.64 CP525 SANKYO 1.31 CDR-H93MV 0F0C FIREBALL ST4.3S PD1225S 3110 LPS525S QUANTUM TEXEL RV M MT-2ST/45S2-27 1.06 CD-ROM 1.0H CD-R55S TEAC TDC 3600 TANDBERG CD-ROM CDU-8012 1.7x CD-ROM CDU-561 1.0i CD-ROM CDU-55S 4.3d CD-ROM CDU-541 SONY 6538 ST1581 ST296 ST157N SEAGATE 1.20 CRD-250S SANYO 2.33 RO3000S RODIME V4-2 PCA80SC PHILIPS CD-ROM DRIVE:841 2.03 RENO CD-ROMX2A MEDIAVIS XT-8760S XT-4170S I1.2 MXT-1240S XT-4380S PR02 XT-3280 MAXTOR 2.06 CDD521/10 CR21 DK314C CM81 DK312C HITACHI DRD-25X DENON CD-ROM CDS-535 CD-ROM CDS-431 CHINON 1.03 IMAGERY 2400SP Aashima scsi_luns_setup : usage max_scsi_luns=n (n should be between 1 and 2^32-1) Vendor: Model: Rev: Type: %s Unknown ANSI SCSI revision: %02x CCS Unable to obtain scsi_result buffer scan_scsis: DANGER, no command blocks scan_scsis_single: no memory scsi: unknown type %d host%d/bus%d/target%d/lun%d DEBUG: dir: "%s" already exists Unlocked floptical drive. scsi: scan_scsis_single: Cannot malloc scan_scsis_single: Host queue == NULL disk sd%c sd%c%c sd.c:Bad block number requested Unknown sd command %d SCSI disk request error: invalid device. <4>(sd_init_onedisk:) Request allocation failure. <4>(sd_init_onedisk:) Memory allocation failure. %s: Spinning up disk... not responding... ready %s : READ CAPACITY failed. %s : status = %x, message = %02x, host = %d, driver = %02x %s : sense not available. %s : block size assumed to be 512 bytes, disk size 1GB. %s : sector size 0 reported, assuming 512. %s : unsupported sector size %d. SCSI device %s: %d %d-byte hdwr sectors (%d MB) %s: test WP failed, assume Write Enabled %s: Write Protect is %s [Gagamel] [%s] Unable to get major %d for SCSI disk <4>scsi_devices corrupt (sd), nr_dev %d dev_max %d Attached scsi %sdisk %s at scsi%d, channel %d, id %d, lun %d removable Device busy for revalidation (usage=%d) dummy device VGA8x8 VGA8x16 %d %s fb%d Warning: Remapping obsolete /dev/fb* minor %d to %d unable to get major %d for fb devs scrollback: map: frame buffer device <3>fbcon_setup: No support for fontwidth %d <4>fbcon_setup: type %d (aux %d, depth %d) not supported fbcon_redraw_bmove width sy != dy <6>usb.c: registered new driver %s <6>usb.c: deregistering driver %s <6>usb.c: new USB bus registered, assigned bus number %d <6>usb.c: USB bus %d deregistered HOME=/ PATH=/sbin:/bin:/usr/sbin:/usr/bin ACTION=%s DEVFS=/proc/bus/usb DEVICE=/proc/bus/usb/%03d/%03d PRODUCT=%x/%x/%x TYPE=%d/%d/%d INTERFACE=%d/%d/%d [RAINBOW] usb_alloc_urb <3>usb: raced timeout, pipe 0x%x status %d time left %d usb_control/bulk_msg: timeout USB %s Root Hub <6>usb.c: USB disconnect on device %d remove ES0,ES1,ES2, PP0 USB IRQ GIO SET Interface: %d Invalid USB device descriptor (NULL POINTER) Length = %2d%s (!!!) DescriptorType = %02x USB version = %x.%02x Vendor:Product = %04x:%04x MaxPacketSize0 = %d NumConfigurations = %d Device version = %x.%02x Device Class:SubClass:Protocol = %02x:%02x:%02x Per-interface classes Audio device class Communications class Human Interface Devices class Printer device class Mass Storage device class Hub device class Vendor class Unknown class Configuration: bLength = %4d%s bDescriptorType = %02x wTotalLength = %04x bNumInterfaces = %02x bConfigurationValue = %02x iConfiguration = %02x bmAttributes = %02x MaxPower = %4dmA Alternate Setting: %2d bLength = %4d%s bDescriptorType = %02x bInterfaceNumber = %02x bAlternateSetting = %02x bNumEndpoints = %02x bInterface Class:SubClass:Protocol = %02x:%02x:%02x iInterface = %02x (Audio) Control Isochronous Bulk Interrupt Endpoint: bLength = %4d%s bDescriptorType = %02x bEndpointAddress = %02x (%s) bmAttributes = %02x (%s) wMaxPacketSize = %04x bInterval = %02x bRefresh = %02x bSynchAddress = %02x <6>%s: %s urb :%p next :%p dev :%p pipe :%08X status :%d transfer_flags :%08X transfer_buffer :%p transfer_buffer_length:%d actual_length :%d setup_packet :%p start_frame :%d number_of_packets :%d interval :%d error_count :%d context :%p complete :%p <3>hub.c: Unable to kmalloc %Zd bytes for hub descriptor <3>hub.c: Unable to get hub descriptor (err = %d) <6>hub.c: %d port%s detected <3>hub.c: Unable to get hub status (err = %d) <3>hub.c: couldn't allocate interrupt urb <3>hub.c: usb_submit_urb failed (%d) <3>hub.c: invalid subclass (%d) for USB hub device #%d <3>hub.c: invalid bNumEndpoints (%d) for USB hub device #%d <3>hub.c: Device #%d is hub class, but has output endpoint? <3>hub.c: Device #%d is hub class, but has endpoint other than interrupt? <6>hub.c: USB hub found <3>hub.c: couldn't kmalloc hub struct <3>hub.c: hub configuration failed for device #%d <3>hub.c: cannot disconnect hub %d <3>hub.c: %s (%d) failed (err = %d) usb_hub_port_status <3>hub.c: Cannot enable port %i of hub %d, disabling port. <3>hub.c: Maybe the USB cable is bad? <3>hub.c: cannot disable port %d of hub %d (err = %d) <3>hub.c: connect-debounce failed, port %d disabled <3>hub.c: couldn't allocate usb_device %d/%s <6>hub.c: USB new device connect on bus%d/%s, assigned device number %d <6>hub.c: USB new device connect on bus%d, assigned device number %d <3>hub.c: error resetting hub %d - disconnecting <3>hub.c: already running port %i disabled by hub (EMI?), re-enabling... <3>hub.c: port %d over-current change <3>hub.c: get_hub_status failed khubd <3>hub.c: Unable to register USB hub driver <3>hub.c: failed to start usb_hub_thread <3>hub.c: attempting to reset root hub! <3>hub.c: USB device not accepting new address (error=%d) <3>hub.c: unable to get device descriptor (error=%d) <3>hub.c: USB device descriptor short read (expected %Zi, got %i) <3>hub.c: unable to get configuration (error=%d) <3>hub.c: failed to set active configuration (error=%d) <3>hub.c: failed to set active alternate setting for interface %d (error=%d) usbdevfs <4>usbdevfs: process %d (%s) did not claim interface %u before use <7>usbdevfs: USBDEVFS_CONTROL failed dev %d rqt %u rq %u len %u ret %d <4>usbdevfs: USBDEVFS_BULK failed dev %d ep 0x%x len %u ret %d <7>usbdevfs: usb_submit_urb returned %d drivers devices <3>usbdevfs: cannot create inode for bus %u device %u <3>usbdevfs: cannot create inode for bus %u devuid devgid devmode busuid busgid busmode listuid listgid listmode %03d <4>usbdevfs: remount parameter error <4>usbdevfs: mount parameter error usbdevfs_read_super: get root inode failed usbdevfs usbfs %s %3d-%3d: %s (truncated) (none) T: Bus=%2.2d Lev=%2.2d Prnt=%2.2d Port=%2.2d Cnt=%2.2d Dev#=%3d Spd=%3s MxCh=%2d S: Manufacturer=%.100s S: Product=%.100s S: SerialNumber=%.100s B: Alloc=%3d/%3d us (%2d%%), #Int=%3d, #Iso=%3d D: Ver=%2x.%02x Cls=%02x(%-5s) Sub=%02x Prot=%02x MxPS=%2d #Cfgs=%3d P: Vendor=%04x ProdID=%04x Rev=%2x.%02x C:%c #Ifs=%2d Cfg#=%2d Atr=%02x MxPwr=%3dmA I: If#=%2d Alt=%2d #EPs=%2d Cls=%02x(%-5s) Sub=%02x Prot=%02x Driver=%s E: Ad=%02x(%c) Atr=%02x(%-4s) MxPS=%4d Ivl=%d%cs unk. c-sec scard still vend. app. data stor. print comm. audio >ifc Ctrl Isoc Bulk Int. (none) (null Cfg. desc.) (truncated) %s %s %s Linux 2.4.19-uc1 hcd.c <3>hcd.c: bogus endpoint (bad maxpacket) <4>hcd.c: use explicit queuing not urb->next <3>hcd.c: whoa! retval %d %s [%x] : %x ISP1161 Registers uHcRevision uHcControl uHcCommandStatus uHcInterruptStatus uHcInterruptEnable uHcInterruptDisable uHcFmInterval uHcFmRemaining uHcFmNumber uHcLsThreshold uHcRhDescriptorA uHcRhDescriptorB uHcRhStatus uHcRhPort1Status uHcRhPort2Status uHcHardwareConfiguration uHcDMAConfiguration uHcTransferCounter uHcuPInterrupt uHcuPInterruptEnable uHcChipID uHcScratch uHcITLBufferLength uHcATLBufferLength uHcBufferStatus uHcReadBackITL0Length uHcReadBackITL1Length uHcITLBufferPort uHcATLBufferPort Chip_id = %x <3>G_hcd_1161.c: internal OHCI error: TD index > length print_int_ed_list %d::: :%p ::%d dm270pmp_host_call : oc_closed = 1 dm270pmp_host_call : unplug = 1 OHCI un freed urb: 0x%p TD Leak, %d free device %d timeout,ed_cnt = %d dev num %d deletion in interrupt G_hcd_1161.c bug in call to s1161_unlink_urb(); use async unlink URB timeout hc_alloc_1161 : init hc_alloc_1161 : !ohci hc_alloc_1161 : kfree(ohci) reset error... GIO DIR0 = 0x%x GIO BITSET0 = 0x%x 1161-OHCI-HC ==> 1161-HC Entered Suspend 1161_read 1161_write [Gagamel] enable GIO 7 => enable EINT7 [Gagamel] start hcd_1161_init ........ Couldn't find 1161-HC 1161-HC Detected 1161-HC Initialization Failed 1161-HC Initialization Successful gagamel_1161 cdroms/cdrom%d SCSI emulation for USB Mass Storage devices usb-storage-%d <2>usb-storage: host_reset() requested but not implemented Host scsi%d: usb-storage Vendor: %s Product: %s Serial Number: %s Protocol: %s Transport: %s GUID: %08x%08x%08x Attached: %s usb-storage <4>usb-storage: Had to truncate MODE_SENSE_10 buffer into MODE_SENSE. <4>usb-storage: outputBufferSize is %d and length is %d. <4>usb-storage: Command will be truncated to fit in SENSE6 buffer. <3>usb-storage: Buffer overrun averted, this shouldn't happen! <4>usb-storage: Had to truncate MODE_SENSE into MODE_SENSE_10 buffer. <3>usb-storage: Buffer length smaller than header!! cdroms/cdrom%d cdroms/cdrom%d 00XLZ6XZBXBBXXXB00LBBLG0R0L0GG0XXXXXT8XXB4B0BBBBZZZ0B00HCSSZTBHHM0HHB0X000H0HH0XXHH0HHXX0TH0H0XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX0XXX00XB0BXBXBBZZZ0XUIDU000XHBXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXXXW00HXXXXXXXXXX cdroms/cdrom%d EasyDisk Portable Device CCYU TECHNOLOGY USBDrive JMTek USB Cable 205 Digital Wallet Minds@Work QV DigitalCamera Casio USB to CF + SM Combo (LC1) Datafab Systems, Inc. Simple Tech/Datafab CF+SM Reader Simple Tech/Datafab PNY/Datafab CF+SM Reader PNY/Datafab Datafab-based Reader Datafab/Unknown SIIG/Datafab Memory Stick+CF Reader/Writer SIIG/Datafab MDCFE-B USB CF Reader Datafab USB-SCSI-HD50 USB-SCSI-DB25 USB-IDE Freecom ImageMate SDDR-09 ImageMate SDDR-12 ImageMate SDDR-31 ImageMate SDDR-05a Flashgate FlashGate SmartMedia Hagiwara Dimage S304 Minolta Camedia MAUSB-2 Olympus Floppy Drive TEAC External Hard Disk EagleTec CompactFlash Card Reader SIIG Jumpshot USB CF Reader Lexar USB Storage Adapter V2 Portable USB Harddrive V2 USB/IDE Bridge (ATA/ATAPI) In-System USB Hard Disk LaCie Flashbuster-U Y-E Data PEG Mass Storage Memorystick MSC-U01N Handycam Memorystick MSAC-US1 Memorystick NW-MS7 DSC-S30/S70/S75/505V/F505/F707 USB Clik! 40 Iomega USB SCSI Adaptor Belkin CD-RW Device eUSB CompactFlash Adapter eUSB ATA/ATAPI Adapter Hifd Sony eUSB MMC Adapter eUSB SmartMedia / CompactFlash Adapter SCM Microsystems ImageMate SDDR09 Sandisk eUSCSI Bridge Shuttle LS-120 Matshita LS-120 Camera Panasonic SL11R-IDE ScanLogic FinePix 1400Zoom Fujifilm DVD-CAM DZ-MV100A Camcorder Hitachi Nex II Digital Frontier Labs CameraMate (DPCM_USB) Microtech CD-Writer+ CD-4e CD-Writer+ 8200e CD-Writer+ USB FDD CD-R/RW Drive Mitsumi usb-storage usb-storage-%d <4>usb-storage: Out of memory Unknown None Control/Bulk Control/Bulk/Interrupt Bulk SCM/ATAPI EUSB/SDDR09 Control/Bulk-EUSB/SDDR09 Datafab Bulk-Only Lexar Jumpshot Control/Bulk Reduced Block Commands (RBC) 8020i QIC-157 8070i Transparent SCSI Uniform Floppy Interface (UFI) ISD200 ATA/ATAPI <4>usb-storage: Unable to start control thread <7>WARNING: USB Mass Storage data integrity not assured <7>USB Mass Storage device found at %d [Gagamel] product = %s [Gagamel] proc_num = %d <6>Initializing USB Mass Storage driver... <6>USB Mass Storage support registered. cdroms/cdrom%d cdroms/cdrom%d %02X cdroms/cdrom%d wr: %02X rd: cdroms/cdrom%d <2>freecom reset called cdroms/cdrom%d cdroms/cdrom%d Transparent SCSI cdroms/cdrom%d %02x cdroms/cdrom%d socket: sockfs [%lu] <3>socki_lookup: socket file changed! <3>sock_release: fasync list not empty! <7>sock_close: NULL inode <6>%s uses obsolete (PF_INET,SOCK_PACKET) <4>socket: no more sockets <2>protocol %d >= NPROTO(%d) <6>Linux NET4.0 for Linux 2.4 <6>Based upon Swansea University Computer Society NET3.039 sockets: used %d <7>sk_free: optmem leakage (%d bytes) detected. sock <2>sk_init: Cannot create sock SLAB cache! skput:over: %p:%d put:%d dev:%s skbuff.c skput:under: %p:%d put:%d dev:%s <3>alloc_skb called nonatomically from interrupt %p <4>Warning: kfree_skb passed an skb still on a list (from %p). <4>Warning: kfree_skb on hard IRQ %p KERNEL: assertion (start <= offset+len) failed at skbuff.c(%d) skbuff_head_cache cannot create skbuff cache KERNEL: assertion (start <= offset+len) failed at datagram.c(%d) 0123456789abcdefghijklmnopqrstuvwxyz 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ enable_dma disable_dma set_dma_addr set_dma_count set_dma_mode set_dma_page get_dma_residue set_dma_sg set_dma_speed kern_fp_enter fp_printk fp_send_sig kd_mksound __do_softirq dump_thread dump_fpu udelay __ioremap __iounmap kernel_thread system_rev system_serial_low system_serial_high __bug __bad_xchg __readwrite_bug enable_irq disable_irq pm_idle pm_power_off __machine_arch_type csum_partial_copy_nocheck __csum_ipv6_magic __raw_readsb __raw_readsw __raw_readsl __raw_writesb __raw_writesw __raw_writesl strcpy strncpy strcat strncat strcmp strncmp strchr strlen strnlen strpbrk strtok strrchr strstr memset memcpy memmove memcmp memscan __memzero __arch_copy_from_user __arch_copy_to_user __arch_clear_user __arch_strnlen_user pci_alloc_consistent consistent_alloc consistent_free consistent_sync __gcc_bcmp __ashldi3 __ashrdi3 __cmpdi2 __divdi3 __divsi3 __lshrdi3 __moddi3 __modsi3 __muldi3 __negdi2 __ucmpdi2 __udivdi3 __udivmoddi4 __udivsi3 __umoddi3 __umodsi3 set_bit test_and_set_bit clear_bit test_and_clear_bit change_bit test_and_change_bit find_first_zero_bit find_next_zero_bit elf_platform elf_hwcap sys_write sys_read sys_lseek sys_open sys_exit sys_wait4 __down_failed __down_interruptible_failed __down_trylock_failed __up_wakeup get_wchan _memcpy_fromio _memcpy_toio _memset_io cpu_arm7_cache_clean_invalidate_all cpu_arm7_cache_clean_invalidate_range cpu_arm7_flush_ram_page cpu_arm7_dcache_clean_page cpu_arm7_dcache_clean_entry cpu_arm7_dcache_clean_range cpu_arm7_dcache_invalidate_range cpu_arm7_icache_invalidate_range cpu_arm7_icache_invalidate_page cpu_arm7_tlb_invalidate_all cpu_arm7_tlb_invalidate_range cpu_arm7_tlb_invalidate_page cpu_arm7_set_pgd cpu_arm7_set_pmd cpu_arm7_set_pte register_exec_domain unregister_exec_domain __set_personality abi_defhandler_coff abi_defhandler_elf abi_defhandler_lcall7 abi_defhandler_libcso abi_traceflg abi_fake_utsname printk acquire_console_sem console_print console_unblank register_console unregister_console dequeue_signal flush_signals force_sig force_sig_info kill_pg kill_pg_info kill_proc kill_proc_info kill_sl kill_sl_info notify_parent recalc_sigpending send_sig send_sig_info block_all_signals unblock_all_signals notifier_chain_register notifier_chain_unregister notifier_call_chain register_reboot_notifier unregister_reboot_notifier in_group_p in_egroup_p hotplug_path exec_usermodehelper call_usermodehelper request_module schedule_task flush_scheduled_tasks inter_module_register inter_module_unregister inter_module_get inter_module_get_request inter_module_put try_inc_mod_count do_mmap_pgoff do_munmap exit_mm exit_files exit_fs exit_sighand _alloc_pages __alloc_pages alloc_pages_node __get_free_pages get_zeroed_page __free_pages free_pages num_physpages kmem_find_general_cachep kmem_cache_create kmem_cache_destroy kmem_cache_shrink kmem_cache_alloc kmem_cache_free kmalloc kfree ksize vfree __vmalloc vmalloc_to_page mem_map remap_page_range max_mapnr high_memory vmtruncate init_mm def_blk_fops update_atime get_fs_type get_super drop_super getname names_cachep fput fget igrab iunique iget4 iput force_delete follow_up follow_down lookup_mnt path_init path_walk path_release __user_walk lookup_one_len lookup_hash sys_close dcache_lock d_alloc_root d_delete dget_locked d_validate d_rehash d_invalidate d_move d_instantiate d_alloc d_lookup __d_path mark_buffer_dirty set_buffer_async_io __mark_buffer_dirty __mark_inode_dirty fd_install get_empty_filp init_private_file filp_open filp_close put_filp files_lock check_disk_change __invalidate_buffers invalidate_bdev invalidate_inodes invalidate_device invalidate_inode_pages truncate_inode_pages fsync_dev fsync_no_super permission vfs_permission inode_setattr inode_change_ok write_inode_now notify_change set_blocksize sb_set_blocksize sb_min_blocksize getblk cdget cdput bdget bdput bread __brelse __bforget ll_rw_block submit_bh unlock_buffer __wait_on_buffer ___wait_on_page generic_direct_IO discard_bh_page block_write_full_page block_read_full_page block_prepare_write block_sync_page generic_cont_expand cont_prepare_write generic_commit_write block_truncate_page generic_block_bmap generic_file_read do_generic_file_read generic_file_write generic_file_mmap generic_ro_fops generic_buffer_fdatasync page_hash_bits page_hash_table file_lock_list locks_init_lock locks_copy_lock posix_lock_file posix_test_lock posix_block_lock posix_unblock_lock posix_locks_deadlock locks_mandatory_area dput have_submounts d_find_alias d_prune_aliases prune_dcache shrink_dcache_sb shrink_dcache_parent find_inode_number is_subdir get_unused_fd vfs_create vfs_mkdir vfs_mknod vfs_symlink vfs_link vfs_rmdir vfs_unlink vfs_rename vfs_statfs generic_read_dir generic_file_llseek no_llseek __pollwait poll_freewait ROOT_DEV __find_get_page __find_lock_page grab_cache_page grab_cache_page_nowait read_cache_page set_page_dirty vfs_readlink vfs_follow_link page_readlink page_follow_link page_symlink_inode_operations block_symlink vfs_readdir __get_lease lease_get_mtime lock_may_read lock_may_write dcache_dir_open dcache_dir_close dcache_dir_lseek dcache_dir_fsync dcache_readdir dcache_dir_ops default_llseek dentry_open lock_page unlock_page register_chrdev unregister_chrdev register_blkdev unregister_blkdev tty_register_driver tty_unregister_driver tty_std_termios blksize_size hardsect_size blk_size blk_dev is_read_only set_device_ro bmap sync_dev devfs_register_partitions blkdev_open blkdev_get blkdev_put ioctl_by_bdev grok_partitions register_disk tq_disk init_buffer refile_buffer max_sectors max_readahead tty_hangup tty_wait_until_sent tty_check_change tty_hung_up_p tty_flip_buffer_push tty_get_baud_rate do_SAK register_filesystem unregister_filesystem kern_mount __mntput may_umount register_binfmt unregister_binfmt search_binary_handler prepare_binprm compute_creds set_binfmt register_sysctl_table unregister_sysctl_table sysctl_string sysctl_intvec sysctl_jiffies proc_dostring proc_dointvec proc_dointvec_jiffies proc_dointvec_minmax proc_doulongvec_ms_jiffies_minmax proc_doulongvec_minmax add_timer del_timer request_irq free_irq irq_stat add_wait_queue add_wait_queue_exclusive remove_wait_queue wait_for_completion complete probe_irq_on probe_irq_off mod_timer tq_timer tq_immediate alloc_kiovec free_kiovec expand_kiobuf map_user_kiobuf unmap_kiobuf lock_kiovec unlock_kiovec brw_kiovec kiobuf_wait_for_io request_dma free_dma dma_spin_lock request_resource release_resource allocate_resource check_resource __request_region __check_region __release_region ioport_resource iomem_resource complete_and_exit __wake_up __wake_up_sync wake_up_process sleep_on sleep_on_timeout interruptible_sleep_on interruptible_sleep_on_timeout schedule schedule_timeout sys_sched_yield jiffies xtime do_gettimeofday do_settimeofday loops_per_jiffy kstat nr_running panic __out_of_line_bug sprintf snprintf sscanf vsprintf vsnprintf vsscanf kdevname bdevname cdevname simple_strtol simple_strtoul simple_strtoull system_utsname uts_sem sys_call_table machine_restart machine_halt machine_power_off _ctype secure_tcp_sequence_number get_random_bytes securebits cap_bset reparent_to_init daemonize csum_partial seq_escape seq_printf seq_open seq_release seq_read seq_lseek do_execve flush_old_exec kernel_read open_exec si_meminfo sys_tz file_fsync fsync_buffers_list clear_inode ___strtok init_special_inode read_ahead get_hash_table get_empty_inode insert_inode_hash remove_inode_hash buffer_insert_inode_queue buffer_insert_inode_data_queue make_bad_inode is_bad_inode event brw_page overflowuid overflowgid fs_overflowuid fs_overflowgid fasync_helper kill_fasync disk_name get_write_access strnicmp strspn strsep tasklet_hi_vec tasklet_vec bh_task_vec init_bh remove_bh tasklet_init tasklet_kill __run_task_queue do_softirq raise_softirq cpu_raise_softirq __tasklet_schedule __tasklet_hi_schedule sys_msgsnd init_task_union tasklist_lock pidhash vm_max_readahead vm_min_readahead fail_writepage zone_table generic_file_open set_buffer_flushtime put_unused_buffer_head get_unused_buffer_head set_bh_page create_empty_buffers writeout_one_page waitfor_one_page try_to_free_buffers bh_cachep nfsd_linkage proc_symlink proc_mknod proc_mkdir create_proc_entry remove_proc_entry proc_root proc_root_fs proc_net proc_bus proc_root_driver fat_new_dir fat_get_block fat_clear_inode fat_date_unix2dos fat_delete_inode fat__get_entry fat_mark_buffer_dirty fat_notify_change fat_put_super fat_attach fat_detach fat_build_inode fat_read_super fat_search_long fat_readdir fat_scan fat_statfs fat_write_inode register_cvf_format unregister_cvf_format fat_get_cluster fat_dir_ioctl fat_add_entries fat_dir_empty fat_truncate fat_brelse msdos_create msdos_lookup msdos_mkdir msdos_rename msdos_rmdir msdos_unlink msdos_read_super msdos_put_super vfat_create vfat_unlink vfat_mkdir vfat_rmdir vfat_rename vfat_read_super vfat_lookup register_nls unregister_nls unload_nls load_nls load_nls_default utf8_mbtowc utf8_mbstowcs utf8_wctomb utf8_wcstombs dm270pmp_push_queue dm270pmp_pop_queue dm270pmp_remove_queue dm270pmp_get_queue dm270pmp_clear_queue dm270pmp_isEmpty_queue dm270pmp_i2c_write_by_dd dm270pmp_i2c_read_by_dd dm270pmp_powerkey_power_immediate_func dm270pmp_powerkey_power_hold_immediate_func dm270pmp_powerkey_power_timer_1st_func dm270pmp_powerkey_remocon_power_timer_1st_func is_lowbattery disable_8sec_timer pmu_goStandBy pmu_goFinalize pmu_remocon_hold_status pmu_lcd_power_on dm270pmp_slidekey_get_func dm270pmp_slidekey_is_hold_status dsp_sdownimg dm270pmp_usbdevice_connected tty_register_ldisc tty_register_devfs tty_unregister_devfs n_tty_ioctl misc_register misc_deregister random_add_entropy add_keyboard_randomness add_mouse_randomness add_interrupt_randomness add_blkdev_randomness batch_entropy_store generate_random_uuid color_table default_red default_grn default_blu video_font_height video_scan_lines vc_resize fg_console console_blank_hook vt_cons take_over_console give_up_console set_selection paste_selection handle_scancode kbd_ledfunc keyboard_tasklet io_request_lock end_that_request_first end_that_request_last blk_grow_request_list blk_init_queue blk_get_queue blk_cleanup_queue blk_queue_headactive blk_queue_make_request generic_make_request blkdev_release_request req_finished_io generic_unplug_device blk_ioctl gendisk_head add_gendisk del_gendisk get_gendisk loop_register_transfer loop_unregister_transfer autoirq_setup autoirq_report ide_hwifs ide_register_module ide_unregister_module ide_spin_wait_hwgroup ide_probe drive_is_flashcard ide_timer_expiry ide_intr ide_fops ide_get_queue ide_add_generic_settings ide_devfs_handle do_ide_request ide_scan_devices ide_register_subdriver ide_unregister_subdriver ide_replace_subdriver ide_input_data ide_output_data atapi_input_bytes atapi_output_bytes drive_is_ready ide_set_handler ide_dump_status ide_error ide_fixstring ide_wait_stat ide_do_reset restart_request ide_init_drive_cmd ide_do_drive_cmd ide_end_drive_cmd ide_end_request ide_revalidate_disk ide_cmd ide_wait_cmd ide_wait_cmd_task ide_delay_50ms ide_stall_queue ide_add_proc_entries ide_remove_proc_entries proc_ide_read_geometry create_proc_ide_interfaces recreate_proc_ide_device destroy_proc_ide_device ide_add_setting ide_remove_setting ide_register_hw ide_register ide_unregister ide_setup_ports hwif_unregister get_info_ptr current_capacity system_bus_clock ide_reinit_drive ide_auto_reduce_xfer ide_driveid_update ide_ata66_check set_transfer ide_config_drive_speed task_read_24 do_rw_taskfile do_taskfile set_multmode_intr set_geometry_intr recal_intr task_no_data_intr task_in_intr task_mulin_intr pre_task_out_intr task_out_intr task_mulout_intr ide_init_drive_taskfile ide_wait_taskfile ide_raw_taskfile ide_pre_handler_parser ide_handler_parser ide_cmd_type_parser ide_taskfile_ioctl export_ide_init_queue export_probe_for_drive scsi_register_module scsi_unregister_module scsi_free scsi_malloc scsi_register scsi_unregister scsicam_bios_param scsi_partsize scsi_allocate_device scsi_do_cmd scsi_command_size scsi_ioctl print_command print_sense print_req_sense print_msg print_status scsi_dma_free_sectors kernel_scsi_ioctl scsi_need_isa_buffer scsi_release_command print_Scsi_Cmnd scsi_block_when_processing_errors scsi_mark_host_reset scsi_ioctl_send_command scsi_allocate_request scsi_release_request scsi_wait_req scsi_do_req scsi_report_bus_reset scsi_block_requests scsi_unblock_requests scsi_get_host_dev scsi_free_host_dev scsi_sleep proc_print_scsidevice proc_scsi scsi_io_completion scsi_end_request scsi_register_blocked_host scsi_deregister_blocked_host scsi_reset_provider scsi_hostlist scsi_hosts scsi_devicelist scsi_device_types scsi_add_timer scsi_delete_timer register_framebuffer unregister_framebuffer registered_fb num_registered_fb GET_FB_IDX fb_alloc_cmap fb_copy_cmap fb_get_cmap fb_set_cmap fb_default_cmap fb_invert_cmaps __fb_try_mode fb_display fbcon_redraw_bmove fbcon_redraw_clear fbcon_dummy fb_con usb_ifnum_to_if usb_epnum_to_ep_desc usb_register usb_deregister usb_scan_devices usb_alloc_bus usb_free_bus usb_register_bus usb_deregister_bus usb_alloc_dev usb_free_dev usb_inc_dev_use usb_driver_claim_interface usb_interface_claimed usb_driver_release_interface usb_match_id usb_root_hub_string usb_new_device usb_reset_device usb_connect usb_disconnect usb_check_bandwidth usb_claim_bandwidth usb_release_bandwidth usb_set_address usb_get_descriptor usb_get_class_descriptor __usb_get_extra_descriptor usb_get_device_descriptor usb_get_string usb_string usb_get_protocol usb_set_protocol usb_get_report usb_set_report usb_set_idle usb_clear_halt usb_set_interface usb_get_configuration usb_set_configuration usb_get_status usb_get_current_frame_number usb_alloc_urb usb_free_urb usb_submit_urb usb_unlink_urb usb_control_msg usb_bulk_msg usb_devfs_handle usb_hcd_giveback_urb memparse get_option get_options init_rwsem __down_read __down_write __up_read __up_write swapper Linux (none) 2.4.19-uc1 #4 2004. 09. 11. ( ) 11:55:04 KST armnommu (none) root=/dev/rom0 /sbin/modprobe /sbin/hotplug kmem_cache TXTME HTM1STLOG C H CPPLISPASFORF MAKINCBASBATSH INIPBMPGMDXFTEX *?<>|" +=,; !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ & % f"g" "4"B&@& 2 3 "*")" '"(" "a"R"j"k" "5"+"," +!0 o&m&j& ! A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~0 %,%$%4%<% %#%3%+%;%K% %/%(%7%?% %0%%%8%B% `$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$`!a!b!c!d!e!f!g!h!i! 3"3M3 363Q3W3 3&3#3+3J3;3 2122292~3}3|3R"a"+"." "5")"*" pOupu AQpS U0[q_ f l)m[t vNz4 W0XDY eZl%u Q.YeY e*j'k vharYN OxSi`)nOz NUO=O bYr;u hwmppLu dkSkWl"o 8N+T sLvT/Z PIQlQ W}YT[][ _R`La fmg!h i_l*mim/n vlx?z KQ;RJT V@zw Ds op XZZh` u:}n [i_Mb c=hsk x&xmy dR(WPgj QBW* \OJR T>d(f zV{"}/ vRf N dce_h YP[M\ c/e\[ lEsIy OPQW[ cBf!k \hcf enq>y R:\Sg|p5rL [Kb1g s.zk yB}M~ NOOEQAS ncs&~ m]y.~ R SGS TFU1U f-fvf~g m nXn~ NHQCS`S ]&bGb g\oNq}q U8o6qhQ |LVQX | }D} XOY=r OtPGRsSo`Ic_g,n cX[k[ dQg\ Y*YplQ _ `Ka4b S'Y,{ n'pSSDU SFOT 9NXS _e`zf`l Z@w-N j&p*s _5_k_ gnoRr:u:wt iCO,o ?ipojW X,[,}*r NNO\PuPCR HT$X xQkX)YU\ T5XWX e\g!n{v %x:x UTXXXWY b-dqgCh uwyI{T{R{ |q}0Rc myrcw z4iJ\ pxVo\ XpzcK ~wuWS`i esNeQ l>m6t4xFZu cWeog sidq /OeRZS Qu`ukQb zVYX 4O$RJS g>lNlHr sTuA~, =cifju *SQS&T `Ibyb k5t w _buF{< }~v, thyh W+YfZ `vbwe enfnm6r&{P R;TtV NuOuQ@Xc^s^ g&N= {OP YGr WUcik+u SFT1XIY bgc>e p2x+~ PVRJW d4ggrfwFz XL^TY,g sT*gE R"Y!q_r xd!j 2Q(g $\;b~| Y:r6 /UQO*Q m6s7s1uPy ma}= qNuSP] Te\Ng n tYukx `tAX m/}^ a#oIq>| N*N1N6NY zUYPYNYZYXYbY`YgYlYiY Z@ZlZIZ5Z6ZbZjZ Z*[6[>[C[E[@[Q[U[Z[[[e[i[p[s[u[x[ \ \"\(\8\9\A\F\N\S\P\O\q[l\n\bNv\y\ ]L]R]N]K]l]s]v] ^6^7^D^C^@^N^W^T^_^b^d^G^u^v^z^ _ _]_\_ _)_-_8_A_H_L_N_/_Q_V_W_Y_a_m_s_w_ _!``` `+`&` `:`Z`A`j`w`_`J`F`M`c`C`d`B`l`k`Y` aGa>a(a'aJa?acMc d&d6d dgdodvdNd*e e$e#e+e4e5e7e6e8eKuHeVeUeMeXe^e]erexe esg5f6f4f fOfDfIfAf^f]fdfgfhf_fbfpf g&g'g8 .g?g6gAg8g7gFg^g`gYgcgdg g|gjg hFh)h@hMh2hNh h+hYhchwh h"i&i h(i*i i#i!i hyiwi\ixikiTi~ini9iti=iYi0iai^i]i jrj6jxjGjbjYjfjHj8j"j k8k7k GkCkIkPkYkTk[k_kakxkyk l$l#l^lUlbljl l~lhlsl 6m+m=m8m m5m3m mdmZmymYm m-nnn.n nrn_n>n#nkn+nvnMn nCn:nNn$n ozoxo ooo[o o|oXo p0p>p2pQpcp qeqUq qfqbqLqVqlq r(r-r,r0r2r;rsNsOs Wsjshspsxsus{szs tot%t s2t:tUt?t_tYtAt\titptctjtvt~t u&u,uz7zCzWzIzazbziz pzyz}z {5{({6{P{z{ {L{E{u{e{t{g{p{q{l{n{ {#|'|*| |7|+|=|L|C|T|O|@|P|X|_|d|V|e|l|u| }E}K}.}2}?}5}F}s}V}N}r}h}n}O}c} ~#~!~ ~"~F~f~;~5~9~C~7~ 2~:~g~]~V~^~Y~Z~y~j~i~|~{~ fE_(N O9OVO O@P"P PFPpPBP PJQdQ S$SrS UYWeW YSY[Y]YcY \']S] B]m] ]!_4_g_ a7a0a f;f f.f f$fefWfYf i0jkjFjsj~j k?l\l m9n\n'n?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ N N!N#N&N)N.N/N1N3N5N7NO?O@OAOBODOEOGOHOIOJOKOLOROTOVOaObOfOhOjOkOmOnOqOrOuOwOxOyOzO}O P P"P#P$P'P /P0P1P2P3P4P5P6P7P8P9P;P=P?P@PAPBPDPEPFPIPJPKPMPPPQPRPSPTPVPWPXPYP[P]P^P_P`PaPbPcPdPfPgPhPiPjPkPmPnPoPpPqPrPsPtPuPxPyPzP|P}P Q Q"Q#Q$Q%Q&Q'Q(Q)Q*Q+Q,Q-Q.Q/Q0Q1Q2Q3Q4Q5Q6Q7Q8Q9Q:Q;QQBQGQJQLQNQOQPQRQSQWQXQYQ[Q]Q^Q_Q`QaQcQdQfQgQx jQoQrQzQ~Q R!R"R#R%R&R'R*R,R/R1R2R4R5RRDRERFRGRHRIRKRNRORRRSRURWRXR YRZR[R]R_R`RbRcRdRfRhRkRlRmRnRpRqRsRtRuRvRwRxRyRzR{R|R~R S"S$S%S'S(S)S+S,S-S/S0S1S2S3S4S5S6S7S8SV@VAVBVCVDVEVFVGVHVIVJVKVOVPVQVRVSVUVVVZV[V]V^V_V`VaV cVeVfVgVmVnVoVpVrVsVtVuVwVxVyVzV}V~V W W!W"W$W%W&W'W+W1W2W4W5W6W7W8WX?X@XAXBXCXEXFXGXHXIXJXKXNXOXPXRXSXUXVXWXYX [X\X]X_X`XaXbXcXdXfXgXhXiXjXmXnXoXpXqXrXsXtXuXvXwXxXyXzX{X|X}X Y Y!Y"Y#Y&Y(Y,Y0Y2Y3Y5Y6Y;Y =Y>Y?Y@YCYEYFYJYLYMYPYRYSYYY[Y\Y]Y^Y_YaYcYdYfYgYhYiYjYkYlYmYnYoYpYqYrYuYwYzY{Y|Y~Y Z!Z"Z$Z&Z'Z(Z*Z+Z,Z-Z.Z/Z0Z3Z5Z7Z8Z9Z:Z;Z=Z>Z?ZAZBZCZDZEZGZHZKZLZMZNZOZPZQZRZSZTZVZWZXZYZ[Z\Z]Z^Z_Z`Z aZcZdZeZfZhZiZkZlZmZnZoZpZqZrZsZxZyZ{Z|Z}Z~Z [ [!["[#[$[%[&['[([)[*[+[,[-[.[/[0[1[3[5[6[8[9[:[;[<[=[>[?[A[B[C[D[E[F[G[ H[I[J[K[L[M[N[O[R[V[^[`[a[g[h[k[m[n[o[r[t[v[w[x[y[{[|[~[ \ \!\#\&\(\)\*\+\-\.\/\0\2\3\5\6\7\C\D\F\G\L\M\R\S\T\V\W\X\Z\[\\\]\_\K d\g\h\i\j\k\l\m\p\r\s\t\u\v\w\x\{\|\}\~\ ] ]!]"]#]%](]*]+],]/]0]1]2]3]5]6]7]8]9]:];]<]?]@]A]B]C]D]E]F]H]I]M]N]O]! Q]R]S]T]U]V]W]Y]Z]\]^]_]`]a]b]c]d]e]f]g]h]j]m]n]p]q]r]s]u]v]w]x]y]z]{]|]}]~] ^ ^!^"^#^$^%^(^)^*^+^,^/^0^2^3^4^5^6^9^:^>^?^@^A^C^F^G^H^I^J^K^M^N^O^P^Q^R^S^V^W^X^Y^Z^\^]^_^`^c^d^e^f^g^h^i^j^k^l^m^n^o^p^q^u^w^y^~^ _!_"_#_$_ (_+_,_._0_2_3_4_5_6_7_8_;_=_>_?_A_B_C_D_E_F_G_H_I_J_K_L_M_N_O_Q_T_Y_Z_[_\_^___`_c_e_g_h_k_n_o_r_t_u_v_x_z_}_~_ `"`#`$`,`-`.`0`1`2`3`4`6`7`8`9`:`=`>`@`D`E`F`G`H`I`J`L`N`O`Q`S`T`V`W`X`[`\`^`_```a`e`f`n`q`r`t`u`w`~` a!a"a%a(a)a*a,a-a.a/a0a1a2a3a4a5a6a7a8a9a:a;aa@aAaBaCa EaFa GaIaKaMaOaPaRaSaTaVaWaXaYaZa[a\a^a_a`aaacadaeafaiajakalamanaoaqarasatavaxayaza{a|a}a~a b b#b&b'b(b)b+b-b/b0b1b2b5b6b8b9b:b;bc?c@cAcDcGcHcJcQcRcScTcVcWcXcYcZc[c\c]c`cdcecfchcjckclcocpcrcsctcucxcyc|c}c~c d"d#d$d %d'd(d)d+d.d/d0d1d2d3d5d6d7d8d9d;dd@dBdCdIdKdLdMdNdOdPdQdSdUdVdWdYdZd[d\d]d_d`dadbdcdddedfdhdjdkdldndodpdqdrdsdtdudvdwd{d|d}d~d e e!e "e#e$e&e'e(e)e*e,e-e0e1e2e3e7e:eg?gAgDgEgGgJgKgMgRgTgUgWgXgYgZg[g]gbgcgdgfgggkglgngqgtgvg xgygzg h h"h#h$h%h&h'h(h+h,h-h.h/h0h1h4h5h6h:h;h?hGhKhMhOhRhVhWhXhYhZh[h \h]h^h_hjhlhmhnhohphqhrhshuhxhyhzh{h|h}h~h i!i"i#i%i&i'i(i)i*i+i,i.i/i1i2i3i5i6i7i8i:i;ii@iAiCiDiEiFiGiHiIiJiKiLiMiNiOiPiQiRiSiUiViXiYi[i\i_i aibidieigihiiijilimioipirisitiuivizi{i}i~i j j"j#j$j%j&j'j)j+j,j-j.j0j2j3j4j6j7j8j9j:j;jl?lClDlElHlKlLlMlNlOlQlRlSlVlXl YlZlblclelflglklllmlnlolqlslulwlxlzl{l|l m m!m"m#m$m&m(m)m,m-m/m0m4m6m7m8m:m?m@mBmDmImLmPmUmVmWmXm[m]m_mambmdmemgmhmkmlmmmpmqmrmsmumvmymzm{m}m~m n"n&n'n(n*n,n.n0n1n3n5n 6n7n9n;nn?n@nAnBnEnFnGnHnInJnKnLnOnPnQnRnUnWnYnZn\n]n^n`nanbncndnenfngnhninjnlnmnonpnqnrnsntnunvnwnxnynzn{n|n}n o!o"o %o&o'o(o,o.o0o2o4o5o7o8o9o:o;op?p@pApBpCpDpEpFpGpHpIpJpKpMpNpPpQpRpSpTpUpVpWpXpYpZp[p\p]p_p`papbpcpdpepfpgphpipjpnpqprpsptpwpypzp{p}p q q!q"q#q$q%q'q(q)q*q+q,q-q.q2q3q4q 5q7q8q9q:q;qq?q@qAqBqCqDqFqGqHq KqMqOqPqQqRqSqTqUqVqWqXqYqZq[q]q_q`qaqbqcqeqiqjqkqlqmqoqpqqqtquqvqwqyq{q|q~q r r!r"r#r$r%r&r'r)r+r-r.r/r2r3r4r:rr@rArBrCrDrErFrIrJrKrNrOrPrQrSrTrUrWrXrZr\r^r`rcrdrerhrjrkrlrmrprqrsrtrvrwrxr{r|r}r 6"'"(" "*")" "%" " "+"."a"L"H"=" "`"n"o"d"e" "5"4"B&@& "2 3 p!q!r!s!t!u!v!w!x!y! $t$u$v$w$x$y$z${$|$}$~$ $`$a$b$c$d$e$f$g$h$i$ 2!2"2#2$2%2&2'2(2)2 `!a!b!c!d!e!f!g!h!i!j!k! A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~0 % 5 "#"R"f"g" "P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s% 1 1!1"1#1$1%1&1'1(1)1 !0"0#0$0%0&0'0(0)0 !!12 % %!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K% s s#s$s&s's(s-s/s0s2s3s5s6s:s;st?t@tBtCtDtEtFtGtHtItJtKtLtMt NtOtPtQtRtStTtVtXt]t`tatbtctdtetftgtht jtktltntotqtrtstttutxtytzt {t|t}t u u!u"u#u$u&u'u*u.u4u6u9uw?wBwDwEwFwHwIwJwKwLwMwNwOwRwSwTwUwVwWwXwYw\w O!Xq `QSc ,g({)] a+R*vl_ [HduQ ]w^w_w`wdwgwiwjwmwnwowpwqwrwswtwuwvwwwxwzw{w|w Uc\S ^ek?| PgMb" QKmB\m x x!x"x$x(x*x+x.x/x1x2x3x5x6x=x?xAxBxCxDxFxHxIxJxKxMxOxQxSxTxXxYxZx [x\x^x_x`xaxbxcxdxexfxgxhxixoxpxqxrxsxtxuxvxxxyxzx{x}x~x S^eEu1U!P g2Vno bHTXN O:\d z=i O9 pvc$ W%f?i QgX[ T{)vSb'YFTyk P4b&^ y y!y"y#y%y&y'y(y)y +y,y-y.y/y0y1y2y3y5y6y7y8y9y=y?yByCyDyEyGyJyKyLyMyNyOyPyQyRyTyUyXyYyaycy dyfyiyjykylynypyqyrysytyuyvyyy{y|y}y~y< y `= e.lFO S_!cZQa RccH [0R;z op{vI{ $XNO pxQ[ W5uCO8u 5XywL X(Tr %Zv` S|bO z!z"z$z%z&z'z(z)z*z+z,z-z.z/z0z1z2z4z5z6z8z:z>z@zAzBzCzDzEzGzHzIzJzKzLzMzNzOzPzRzSzTzUzVzXzYzZz[z\z]z^z_z`zazbzczdzezfzgzhz izjzkzlzmznzozqzrzszuz{z|z}z~z Q[O&T+Ywe u[vb {!{"{#{'{){-{nm ybec \/n`g ?zJT urRi /{0{2{4{5{6{7{9{;{={?{@{A{B{C{D{F{H{J{M{N{S{U{W{Y{\{^{_{a{c{d{e{f{g{h{i{j{k{l{m{o{p{s{t{v{x{z{|{}{ `Lp/ -WExR_ xvBh | |!|"|#|$|%|(|)|+|,|-|.|/|0|1|2|3|4|5|6|7|9|:|;|<|=| i[wm&l qWlIl/Ymg* SimuT N*ja O4ss mOW"k [{^R `LqCfL^M` pp%c `gaIS `ff? fZZB W:gxu=z }!}#}$}%}&}(})}*},}-}.}0}1}2}3}4}5}6} urlsS OmyBR g9YsO GP}?}@}A}B}C}D}E}F}G}H}I}J}K}L}M}N}O}P}Q}R}S}T}U}V}W}X}Y}Z}[}\}]}^}_}`}a}b}c}d}e}f}g}h}i}j}k}l}m}o}p}q}r}s}t}u}v} x}y}z}{}|}}}~} }eP0 \Fm_l hhVY RYeu Thpgwckw N%m_ [wvf Xle\ ENxp]NR uE\y pgRPcC Z&P7wwS ~ ~!~"~#~$~%~&~'~(~)~*~+~,~-~.~/~0~1~2~3~4~5~6~P 8~9~ :~<~=~>~?~@~B~C~D~E~F~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~ S4nKQ;R Ws`QW-TzzP`T[ WWw{ [>k!SP{ ^~_~`~a~b~c~d~e~f~g~h~i~j~k~l~m~n~o~p~q~r~s~t~u~v~w~x~y~z~{~|~}~~~ h^i. ^[e8 cdSO yU_F fba+o h_[/w %_s| T}T, xidT RUa(g vfwgrFz lCNvY WS7u }[nUJ l[rmb T'k% UTvP _Cn>m vTu$R PA\l {OPGr RNjW O\aW FZ4xD |VRQb Wnffm1 hGYgkfu eHyAy O/T p`=murfb MR\oc XL] kIk g[TT bGj9 "l>P ^\ sTOu MO-n \pakS ~;T3z LNal h>T4T NBcHS dfir wpf;V8T! -^`N Z>fi XnaN \][!h {HeTi NGkN x^Og'` ^\ud`n} cv)w f[tz @T+N co Gd'\e 0iNV6 Q_Nu 1jtZp lx f R(u}^ _$\1u l8nI ?a(`b S8xBg=h U#n-gg -]U\8 zp_3o _ b-f~b #cAw bck?e g/e1T AlKN kgb

S\ fScS R-R3R?R@RLR^RaR\R N"OdO N%O'O O+O^OgO8eZO]O _OWO2O=OvOtO O~O{O O)PLP P.P-P P%P(P~PCPUPHPNPlP{P N=lXOeO Flt|nQ iSzS X)W,W*W3W9W.W/W\W;WBWiW W|W{WhWmWvWsW XDX XeXlX _]4]=]l][]o]]]k]K]J]i]t] ]s_w_ s"s9s%s,s8s1sPsMsWs`slsos~s `5`&` `)`+` `?`!`x`y`{`z`B` j`}` ` a&a a+aJaua ,N?r b5lTl\lJl lhliltlvl 9m'm mCmHm m+mMm.m5m mOmRmTm3m m\m`m|mcm m+nnnNnkn nSnTn2n%nDn nboFoGo$o n/o6oKoto*o o)o oxoro|ozo p9p5pOp^p P_W_V_X_;\ TP\Y\q[c\f\ *_)_-_t Z Z2Z4Z Z@ZgZJZUZhJhIh)h hthwh iqi9i`iBi]i ixi4i ificiyi iDj>j jPj[j5j jyj=j(jXj|j j7sRs b"b!b%b$b,b f4f1f6f5f _fTfAfOfVfafWfwf r]rfror~r l!l)l$l*l2l5eUekeMrRrVr0rb $k7k9kCkFkYk q/q1qsq\qhqEqrqJqxqzq r(rlp q>b=bCbHbIb;y@yFyIy[y\ySyZybyWy`yoygyzy <`]`Z`g`A`Y`c` x9x:x;x xv3vMv^vTv\vVvkvov zxzyz {G{8{*{ {.{1{ %{${3{>{ {X{Z{E{u{L{]{`{n{{{b{r{q{ |*|&|8|A|@| ||Ie !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ % & %"< `"d"e" 2 3 B&@& " "a"R" 0j"k" "5"+"," "*")"'"(" !0 %d&`&a&e&g&c& ! !m&i&j&l& e1f1g1h1i1j1k1l1m1n1o1p1q1r1s1t1u1v1w1x1y1z1{1|1}1~1 p!q!r!s!t!u!v!w!x!y! `!a!b!c!d!e!f!g!h!i! %,%$%4%<% %#%3%+%;%K% %/%(%7%?% %0%%%8%B% %!%"%&%'%)%*%-%.%1%2%5%6%9%:%=%>%@%A%C%D%E%F%G%H%I%J% `2a2b2c2d2e2f2g2h2i2j2k2l2m2n2o2p2q2r2s2t2u2v2w2x2y2z2{2 $`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$ S!T! [!\!]!^! $t$u$v$w$x$y$z${$|$}$~$ A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~0 =OsOGP ;RtS Tj`da Yr^y^ RNW*XL] a!bbe ^:_J_wa_lzu QOX7a>aha9e aWiq Ppg@h Q uy}m~ bzlToP}: |QJa dleof OSU:XQYc[F\ nLuxv |k~|~ SJTqT Yd[;\ b7eEere v~w?z h@z7 OlQqQ ]P`m` h>kLp/t .R]` OIQ!S X*`'a ]*eNe!hKj NEN]N &P8R SWsh jpom wfxk S-WNY RGWGu`{ XjKQKR i~tK{ S%`qbrl UhV;W h_j:k#l}l s&t*t xAyGyHyzy }vO T OczcWS! g`isn" gQHY sYt^ tY)_ VUMW m[nmo lSuT{ XXXb^ WnW'Y W5XWX rhscw aqgPh q{vI{ sa}= ^na>b p+yb b#e#o o>|us _'g'p t`|~ !Q(pbr XAZb\ o;v/}7~ p t`tYu$vkx, mQ.bx ul|y |idjt [U^ o NMS)Z ]N_ba=cif n+ocp kdqu Y=^Uaxdyd k_rarAt8w vfwFz l"Y&g c4fsg:n+s eYifk s]uF~ R;TOU lirsT Z>\K]L_ hcie cogCn /OpO g"h}v~vD qjud OO{p h>lNl PuQ[\w^ O!X1X [nfek mzn}o ,gvN q+t+~ PVRoR&T W+YfZ Z[u[ vbwe n6r&{?|6 R)TtV XTYnY h|xC~l S*SQS aIbyb V*[l_ a7lX N:Oy@y`y P*Rq\ceUl `QhajXn=r@r az"}r u%um r^tn{n} YmY-^ [Gb~e e2n}q hSQ\Ti l)m+n f_f)s z9{0}o S/VQX {+| }9}, Ol\_g d6exe9j t&vaw hoiSj i]_t Z8\N\M\ e/fBf O{T Z NASs ORQ^U%Z \ cOfHhT3T qRs}{ ]%sOu Q/X-Y zG~^~ ~a2ktm qbt(u,us NQOvP*Q e1f/h\q6z [(`?a l9mrn n0r?sWt MOIP Z \pa f-n2rKt [|^}^ c8e g aibi o6s7s \t1u AQkY9\ Wi`Ga _[_!` NZO~O eQDS NiRU[ YP[W[\[c`Ha e(f|p {*|6 N S4X k?oFr [MbPg=h n}p!~ GONO2Q bugni [Xdue {M|>~ COzO PhQxQMRjRaX|X`Y Nq t0u8uQurvL{ bYmdv {v}`S czdv N\PuPHT `:c?ete evfxf jck@l s:u[w R|U$X omy,{ onogq t:wVyZy |D}p~ m.t.zB} }1~k POPW ^+cj ;NOO jThT ^]f1g l2mJn \Yf=jZm jkiAlz T0W@W cod/e gbk`l w%xIyWy z7zT~w UuX/c"dIfKfmh ]!kdk Ic>d@w d-g.} SyXXaYa P!PuR1Um,r6t4xw $RBW SLciO OOPAbGr jWs^ O}Rj_SaSg thyh 9S<_ lUtw Xx[P eWl"o bmgAh l/n8 WZYi[ awiwm#p Px^OgG s)wMwC}b}#~7 Q[tz@ OTS>Y \>cym sitJ nQW_ \'_6bHb r%tZt m>n?tB [:jkpuu xkz8N cakefSh n>sA `0aLaCfDf nboLq {'|R oppjsj~ V][He _=gfq fJq1 pfug k=kFk8Tp`=m a1b^f !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ & % P 0 0> 05 2 f"g"`" "R"c"b )"*" 3+"."5"4"@&B&A& & !%"#" ! !i "YQ[Q^Q]QaQcQ %<%4%,%$% n%p%o% %q%r%s% `!a!b!c!d!e!f!g!h!i!!0"0#0$0%0&0'0(0)0 1 1!1"1#1$1%1&1'1(1)1$ NCN]N N?QeQkQ SAS\S N+N8N QENHN_N^N P[Q[S[ \"\8\q\ -N0N^ KN9\ NCQAQgQ nQlQ S9SHSGSES^S X)Y+Y*Y-YT[ \$\:\o\ b6bKbNb/e g(g kbkyk l4lkp*r6r;rGrYr[r N;NMNONNN NEQDQ NJSISaS`SoSnS .Y1YtYvYU[ ^s^|^ bSbTbRbQb e.g,g*g+g-gck l8lAl@l>l u(u)u0u1u2u3u NRNSNiN OIQGQFQHQhQ S!S SpSqS T V3W0W(W-W,W/W)W Y7Y8Y Y}YyY YW[X[ bcb[bXb6e f g=g4g1g5g!kdk{k l]lWlYl_l`lPlUlal[lMlNlpp_r]r~v NMOOOGOWO^O4O[OUO0OPOQO=O:O8OCOTOT&TNT'TFTCT3THT T)TJT9T;T8T.T5T6T TWPWOW;W Y][\[Z[[[ [,\@\A\ _d_b_w_y_ b|b~bybsb b9e;e8e OgPgQg\gVg^gIgFg`g SgWgek kBl^l ljlzl lrl~ltl lvp|p}pxpF ar`r s,u+u7u8u &NVNsN OpOuO OiO{O OzOTQRQUQx wQvQxQ Q;R8R7R 0R.R6RAR RRSTSSSQSfSwSxSyS SsTuT T{TwT TqTvT TbThT WwWjWiWaWfWdW|W YIYGY DYTY Y_[d[c[ \H\E\ ^&_'_)_ `/`5` `!`'`)`+` b?b>b@b gsgwg ogpg g|gjgrg#kfkgk ,r-r8rHrgrir w>y@yAy yzzyz QNRCRJRMRLRKRGR SWS{S WUY OYNYPY \N\O\M\K\ _-_e_ ` `%` `(`M`p`h`b`F`C`l`k`j`d`Ab c?eEe e%f-f f'f/f f(f1f$f m2m*m ;m=m>m6m l9m'm8m)m.m5m p0rrrortr u-uOuLuNuKu xFyIyHyGy O&P%P O-P*P P|Q QVR\RTR[R]R*S YWYXYZY Y Z#Z)Z%Z Z Zk[X\ \Q\U\P\ ]-^+^ c`e`P`U`m`i`o` bNc>c/cUcBcFcOcIc:cPc=c*c+c(cMcLcHeIe BfIfOfCfRfLfEfAf !h8hHhFhSh9hBhTh)h LhQh=h gPh@hSk fFUjUfUDU^UaUCUJU1UVUOUUU/UdU8U.U\U,UcU3UAUWU W YbY6ZAZIZfZjZ@Z wk:k=k k.l/l,l/n8nTn!n2ngnJn n%n#n n[nXn$nVnnn-n&non4nMn:n,nCn nNncnDnrnin_n q&q0q!q6qnq r6s%s4s)s:t*t3t"t%t5t6t4t/t t&t(t%u&ukuju u{v|v w]xlxox zI{V{F{P{R{T{M{K{O{Q{ |^}P}h}U}+}n}r}a}f}b}p}s} RwR}R QXXXWX TXkXLXmXJXbXRXKXgY Zi]o]L^y^ aNaLa Ma>a4a'a a7a!b"b d*d-d=d,d Ziwi`iTiui0i iJihiki^iSiyi i]ici[iGkrk nNqYqiqdq gq\qlqfqLqeq^qFqhqVq:rRr7sEs?s>sotZtUt_t^tAt?tYt[t\tvuxu v[wkwfw^wcw ywjwlw\wewhwbw xzy< {`{n{g{ }[}n WuX~X X%Y"Y$YjYiY ][^c^U^W^T^ _F_p_ ?aKawabaca_aZaXaua*b dXdTd dxd_dzdQdgd4dmd{dre iIkLk3l3o n)o>o o,oN o1o8o2o o+o/o rDsPsdtctjtptmt y.z1z S.V;V9V2V?V4V)VSVNVWVtV6V/V0V XmY [ ]b^_^a^ ^H_q_ _vagana]aUa |apaka~a idodyd duewei i!jL jPkNk k?o|o oQofoTo omo[oxono ozopodo noo`o_o rNsWs u v)v v$v&v!v"v x?z~F~P 2~C~+~=~1~E~A~4~9~H~5~?~/~D 8[]_ j_kxk uVvXv azbz`z z+|'|*| |#|!|{ T~U~^~Z~a~R~Y~H u_vav ykziz ?|8|=|7|@|k~m~y~i~j~ X@[C[}[ j>p0p2p2 tbvev&y ,y+y zL|C|M| }~|~ 7Q8Q g9g8g;g:g?gOgORO_OAOXO-O3O?OaO R ScSrS S0T7T*TTTET =TOTAT(T$TGT VAWEWLWIWKWRW [(\*\ _x_v_ bqb{bzbpb bwb}brbtb7e eEgGg YgUgLgHg]gMgZgKg lxlglkl lqlolil lflslel{l ltpzpcr s:u9u v=y4 OvOtO OwOLO OkOnO Q5R2R3RFR1R TkTzT~TeTlTtTfT ToTaT`T TcTgTdT oWrWmWkWqWpWvW WuW{WsWtWbW hW}W Yb[e[ [D\G\ ^(_"_#_$_T_ _~_}_ _-`&` `,`"` gxgyg t?u@u>u wBy?y yxz{z ODRIR R=S|S ]!^"^#^ ^$^ _._V_ _7`9`T`r`^`E`S`G`I`[`L`@`B`_`$`D`X`f`n`BbCb[ bAeCe e6f!f2f5f f&f"f3f+f:f f4f9f.f k l!l(m4m-m mZMZ9ZLZpZiZGZQZVZBZ\Zr[n[ ]&]%] ].]>^4^ ^6_8_ `2cec cpcSe eefaf[fYf\fbf hmhnh hVioh huhth h|hkhrh hqh~h hxh{h h}h6k3k7k8k q~r{r|r tducu v9w/w-w1w2w4w3w=w%w;w5wHxRxIxMxJxLx&xExPxdygyiyjycykyay z5{G{4{%{0{"{${3{ {1{+{-{/{2{8{ |5}=}8}6}:}E},})}A}G}>}?}J};}(}c UwUEV W)X7X X'X#X(X WHX%X X3X?X6X.X9X8X-X,X;XaY Z{Z}Z \0\7]C]k]A]K]?]5]Q]N]U]3]:]R]=]1]Y]B]9]I]8]<]2]6]@]E]D^A^X_ c2egejede\eheee |flf{f fqfyfjfrf h9k;k?k QzRxR{R|R WSXhXdXOXMXIXoXUXNX]XYXeX[X=XcXqX \3\q]c]J]e]r]l]^]h]g]b] ]O^N^J^M^K^ `IaJa+aEa6a2a.aFa/aOa)a@a bh #b%b$b d d d$d 3dCd d9d7d"d#d d&d0d(dAd5d/d d@d%d'd d.d!d fxf gfi_i8iNibiqi?iEiji9iBiWiYiziHiIi5ili3i=iei hxi4iii@ioiDiviXiAitiLi;iKi7i\iOiQi2iRi/i{iV8V*V:V ]i^]^`^\^ a-bndpd dvezeye{e lAo&o~o oboOo ovolo oUoroRoPoWo oaoko}ogo ocowojo{o rXsRs^s_s`s]s[sasZsYs t|tyt u~u%v yvk9z SpV`VnV sVfVcVmVrV^VwV ]g^h^f^o^ f#g4jfjIjgj2jhj>j]jmjvj[jQj(jZj;j?jAjjjdjPjOjTjojij`j[?[ p'p p p+p!p"p#p)p ygzhz3|<|9|,|;| |v~u~x~p~w~o~z~r~t~h~K j?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ DM270 Video Framebuffer 1 DM270 Video Framebuffer 2 DM270 OSD Framebuffer 1 DM270 OSD Framebuffer 2 %$%4%,% %d"e" :&;&e&f&c&`&" %B&@&j&k&<& %$%a%b%V%U%c%Q%W%]%\%[% %4%,% %<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j% )"a" e"d" #!# :&;&e&f& %c&`&" %B&@&j&k&<& %$%a%b%V%U%c%Q%W%]%\%[% %4%,% %<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j% )"a" e"d" #!# `'^~", [17~ [18~ [19~ [20~ [21~ [23~ [24~ [25~ [26~ [28~ [29~ [31~ [32~ [33~ [34~ ttyS a 8ll8 l~3f lz6j 6666 66666666666 66666 6666 666676666670? ?0766666 66666707666 6666 6666666? ?6666666 llll ffff| ff< 0`~`0 8ll8 l6666 <<<<<<< 8ll8 6666666 66666666 66666666 66666 666666666666666666666666 6666666666666 6666666 66666667666666666666670? ?076666666666666 666666666666670766666666 66666 66666666 6666666 666666666666666? ?666666666666666 66666666 llllll ffffff|`` ffff< 0``|```0 8ll8 l66666 ~~~~~~~ UUUUUUUU UUUU UUUU ((((( AAAAAA BBBBBB profile= debug quiet load_ramdisk= root= rootflags= rootfstype= prompt_ramdisk= ramdisk_start= nohlt reboot= root=/dev/rom0 l??b noalign nocache nowb panic= CONSOLE= console= reserve= memfrac= ramdisk= ramdisk_size= ramdisk_blocksize= max_loop= scsi_logging= scsihosts= max_scsi_luns= video= *6BNJV&F.2R: e^>t vyb6 jRYd^ *6BNJV&F.2R: e^>t b\N&r zjn"v6vQRV *6BNJV&F.2R: e^>t = s 2.*CH_. :"B4B !!"""!!! !"#$%&'&&%(#"! )) !#%*+,---.,+*%("! ) "$*,/,00$%'+,/12%#! ))) "%345!66666666!+/,0(! !$3-'666666666666!1-2$! ))) !(*4%6666666666#2'!6*-*(! ) ) "&,566666666666%/72"651'" ))) #*/"66666666666&885%6!-+$! !$99666666666666%+0("66'40# )) !&-&666666666666""666666-3(! ) "0/#66666666666666666666+,%! )) #*4666!"66666666!#"66666(4'" ) #2/66!!$'!66666('"3$6666"/*# ))) #2/660:8$$666#/;<=0%!6666/2# #2/6#>?@:"66!ABCDE>#!6666/3(! ) ))) #2/6+D@FG566&CHIJKL.6666615$! #246MN%/FJ"#2OP!1QRS6666615$! ) ))) #*/!:M!1TU(0+KM6#2P?66666.9$! ) ) ) #*8#7U6(:VWWX6.& @80( 91)! ;3+# =5-% ?7/' 91)! :2*" ;3+# <4,$?7/' >6.& =5-% (3-!0,1'8"5.*2$ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz QZ^& /var/run/utmp /etc/passwd /etc/passwd (nil) (null) %.*s %0*d %.*d %c%+.2d +0-#'I npxXoudifFeEgGaACScs hlLjztqZ Unknown error Success Operation not permitted No such file or directory No such process Interrupted system call Input/output error No such device or address Argument list too long Exec format error Bad file descriptor No child processes Resource temporarily unavailable Cannot allocate memory Permission denied Bad address Block device required Device or resource busy File exists Invalid cross-device link No such device Not a directory Is a directory Invalid argument Too many open files in system Too many open files Inappropriate ioctl for device Text file busy File too large No space left on device Illegal seek Read-only file system Too many links Broken pipe Numerical argument out of domain Numerical result out of range Resource deadlock avoided File name too long No locks available Function not implemented Directory not empty Too many levels of symbolic links No message of desired type Identifier removed Channel number out of range Level 2 not synchronized Level 3 halted Level 3 reset Link number out of range Protocol driver not attached No CSI structure available Level 2 halted Invalid exchange Invalid request descriptor Exchange full No anode Invalid request code Invalid slot Bad font file format Device not a stream No data available Timer expired Out of streams resources Machine is not on the network Package not installed Object is remote Link has been severed Advertise error Srmount error Communication error on send Protocol error Multihop attempted RFS specific error Bad message Value too large for defined data type Name not unique on network File descriptor in bad state Remote address changed Can not access a needed shared library Accessing a corrupted shared library .lib section in a.out corrupted Attempting to link in too many shared libraries Cannot exec a shared library directly Invalid or incomplete multibyte or wide character Interrupted system call should be restarted Streams pipe error Too many users Socket operation on non-socket Destination address required Message too long Protocol wrong type for socket Protocol not available Protocol not supported Socket type not supported Operation not supported Protocol family not supported Address family not supported by protocol Address already in use Cannot assign requested address Network is down Network is unreachable Network dropped connection on reset Software caused connection abort Connection reset by peer No buffer space available Transport endpoint is already connected Transport endpoint is not connected Cannot send after transport endpoint shutdown Too many references: cannot splice Connection timed out Connection refused Host is down No route to host Operation already in progress Operation now in progress Stale NFS file handle Structure needs cleaning Not a XENIX named type file No XENIX semaphores available Is a named type file Remote I/O error Disk quota exceeded No medium found Wrong medium type rmmod ../bin/busybox plsmod ../bin/busybox modprobe ../bin/busybox route ../bin/busybox (2qyifconfig ../bin/busybox getty ../bin/tinylogin insmod ../bin/busybox Khalt ../bin/busybox .update ../bin/busybox &freeramdisk ../bin/busybox .var mnt/ramdisk/var -7default_dir <`.. >Tld-xflat.so ld-xflat.so.1 "modules $2.4.19-uc1 )kernel udspvif.o gfff| decode_queue_init:QueueStructAddr: 0x%08X decode_queue_next_vframe:VideoQueueFull decode_queue_next_aframe:AudioQueueFull DSP/VIF Interrupt Driver Copyright (C) 2003 Ingenient Technologies, Inc. 4.0.6 %s v%s, %s dsp_intr Can't get major number %d. IRQ already attached. Unable to get IRQ %d for DSC_DSP_IRQ dsp_intr_ioctl: DSP_INTR Attached IRQ already detached. dsp_intr_ioctl: DSP_INTR Detached dsp_intr_ioctl: *** DSP_INTR_MAKEINT *** dsp_intr_ioctl: *** DSP_ENCODE_RESET *** dsp_intr_ioctl: s_dsp.encodeQueueSize = %d dsp_intr_ioctl: *** DSP_ENCODE_SET_QUEUE_ADDR *** dsp_intr_ioctl: Undefined ioctl number %d Driver already in use. dsp_intr_open: DSP_INTR opened dsp_intr_release: DSP_INTR released dsp_intr_interrupt: Too many IPC message pending dsp_intr_interrupt: Calling kill_fasync()... HDI_writeData16: Max message size exceeded, %d words HDI_readData16: Max message size exceeded, %d words HDI_writeCmdToDSP: Max message size exceeded, %d words dsp_intr_post_dsp_message: Too many DSP messages in queue dsp_intr_process_vif: Drop Frame JPEGEncode:*** JPEG ENCODE PARAMS *** ==> InputBufAddr: 0x%08X ==> OutputBufAddr: 0x%08X ==> OutputBufSize: 0x%08X ==> Image Dimensions: %ux%u (wxh) ==> InputBufWidth: %u ==> InputFormat: %u ==> qFactor: %u ==> conv422to420: %u ==> lineDouble: %u ==> createEmbeddedTable: %u ISR-ServiceVideoEncode: Video Encode Error (%u) ISR-ServiceVideoEncode: FRAME TOO LARGE FOR QUEUE (0x%08X)n ServiceVideoDecode: VideoDecodeError = %d ServiceVideoDecode: Unknown video decode state %d dspvif status dqueue %s v%s =============================== EncodeQueuedFrames: %d NumMessages: %d EncodeStartTime: %lu EncodeFrameCount: %lu MaxQueueDepth: %d EncodeEnable %d EncodeNow: %d WaitForRsp: %d %s v%s =============================== VideoIndexAddr: 0x%08X AudioIndexAddr: 0x%08X VideoBufAddr: 0x%08X AudioBufAddr: 0x%08X videoHeadOffset: 0x%X audioHeadOffset: 0x%X VideoQueueSize: 0x%X AudioQueueSize: 0x%X MaxVideoEntries: %u MaxAudioEntries: %u MaxEntrySize: 0x%X NumVideoFrames: %u NumAudioFrames: %u kdspvif <6> sys_msgsnd error %d kdecode queue_init: initializing queue... queue_init: Not enough memory in queue to store indices. queue_init: Not enough memory to create queue. queue_reset: resetting queue... queue_add_copy: No more space for entries(%d) queue_add_copy: Encode Queue Buffer Is Full (%d)! queue_get_entry: Queue is empty queue_get_entry: Errror while getting entry ringbuf_put_entry: (1) head ptr would cross tail ptr! ringbuf_put_entry: ***** REACHED BOTTOM ****** --> ring->head: 0x%08X ringbuf_put_entry: (2) head ptr would cross tail ptr! ringbuf_get_entry: (1) tail ptr would cross head ptr! ringbuf_get_entry: ***** REACHED BOTTOM ****** --> ring->tail: 0x%08X ringbuf_get_entry: (2) tail ptr would cross head ptr! Video Interface Interrupt Driver Copyright (C) 2003 Ingenient Technologies, Inc. 3.0.1 vif_intr Can't get major number %d. IRQ already attached. Unable to get IRQ %d for VIF_IRQ vif_intr_ioctl: VIF_INTR Attached IRQ already detached. VIF_INTR detached. Capture Buffer Addr: 0x%08X Full Buffer Addr: 0x%08X Prev Buffer Addr: 0x%08X : framerate value error vif_intr_ioctl: Encode 1, Skip %d vif_intr_ioctl: Fields Skip: %d vif_intr_ioctl: VIF_INTR resetting capture vif_intr_ioctl: Undefined ioctl number %d Driver already in use. vif_intr_open: VIF_INTR opened vif_intr_release: VIF_INTR released vif_intr_interrupt: Calling kill_fasync()... Full Buffer Addr: 0x%08X Prev Buffer Addr: 0x%08X Capture Buffer Addr: 0x%08X <6> sys_msgsnd error %d kernel_version=2.4.19-uc1 author=Jay J. Williams description=Processes interrupts form the DSP and VIF kernel_version=2.4.19-uc1 GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) .symtab .strtab .shstrtab .text .rel.text .fixup .rel.fixup .rodata __ex_table .rel__ex_table .modinfo .data .rel.data .bss .comment gcc2_compiled. __module_kernel_version desc author version proc_dspvif_root dsp_intr_fops dsp_intr_ioctl dsp_intr_open dsp_intr_release dsp_intr_fasync reset_variables proc_dspvif_create dspmsgWaitQueue s_dsp zeroValue dsp_intr_thread dsp_decode_thread proc_dspvif_remove dsp_intr_interrupt RC_Init dsp_intr_post_dsp_message JPEGEncode returnFrame encodeFrame video_encode_task video_decode_task ServiceVideoEncode ServiceVideoDecode HDI_readData16 HDI_writeData16 dspMessage HDI_writeCmdToDSP HDI_dspcMakeINT messageQueue send_dsp_message desiredVideoKBitrate AvgBytesPerFrame rcAdjThreshold bufferOccupancy frameDropThreshold RC_CalcKbpsAdjustment RC_UpdateBufferOccupancy RC_CheckIfBufferFull the_frame.0 proc_dspvif_stats proc_dqueue_stats ringbuf_init ringbuf_put_entry ringbuf_get_entry vif_intr_fops vif_intr_ioctl vif_intr_open vif_intr_release vif_intr_fasync s_vif preview ccdc vif_intr_interrupt vif_task vif_intr_tq vifMessage free_irq daemonize dispbuf_insert_frame schedule_task decode_queue_get_aframe __this_module bh_task_vec decode_queue_commit_aframe decode_queue_audio_full kernel_thread kill_fasync __module_author unregister_chrdev cleanup_module memcpy decode_queue_commit_vframe dispbuf_queue_full add_wait_queue do_gettimeofday __udivsi3 __wake_up init_module create_proc_entry register_chrdev decode_queue_clear_video schedule request_irq decode_queue_next_aframe dsp_intr_cleanup dsp_intr_init sys_msgsnd __umodsi3 decode_queue_get_vframe queue_get_entry fasync_helper decode_queue_clear_audio decode_queue_full vif_intr_cleanup printk vif_intr_get_frame proc_mkdir queue_reset __module_description decodeWakeupEvent test_and_set_bit __memzero vif_intr_reset_capture decode_queue_init dispbuf_osd_set_main_video queue_add_copy __divsi3 dsp_intr_process_vif vif_intr_init sprintf remove_proc_entry __arch_copy_from_user tq_immediate __tasklet_hi_schedule remove_wait_queue decode_queue_video_full decode_queue_next_vframe decodeWaitQueue queue_init aEbuild /ldata/young/cadenux-dm270-4th-fw-0515/linux timer3.o Timer3 Interrupt Driver Copyright (C) 2002 Ingenient Technologies, Inc. 1.2.4 kernel_version=2.4.19-uc1 %s v%s, %s timer3 Can't get major number %d. Verify error. IRQ already attached. Unable to get IRQ %d for TIMER3_IRQ IRQ already detached. Undefined ioctl number %d Driver already in use. <6> sys_msgsnd error %d status history %s v%s Interrupt counter: %lu Missed Interrupts: %lu Mode: 0x%X Prescale: 0x%X DIV/Count: 0x%X Cur. Count: 0x%X MSG ID: %d MSG Type: %ld Intr Flag: %d INTR0_STATUS: 0x%04X INTR0_ENABLE: 0x%04X GCC: (GNU) 2.96 20000110 (experimental) .symtab .strtab .shstrtab .text .rel.text .data .rel.data .bss .modinfo .rodata .comment gcc2_compiled. __module_kernel_version desc author version proc_timer3_root timer3_fops timer3_read timer3_ioctl timer3_open timer3_release timer3_fasync proc_timer3_create s_timer3 timer3_watch_timer timer3_watchdog proc_timer3_remove timer3_interrupt timer3_task timer3_intr_tq timerMessage proc_timer3_display_info proc_timer3_display_history timer3_init printk register_chrdev cleanup_timer3 unregister_chrdev free_irq request_irq __arch_copy_from_user add_timer jiffies __this_module fasync_helper __arch_copy_to_user del_timer schedule_task kill_fasync sys_msgsnd proc_mkdir create_proc_entry remove_proc_entry sprintf init_module cleanup_module E,@binfmt_xflat.o <3>BINFMT_XFLAT: Error reading ld-xflat.so (read size=%ld bytes, error=%d)! <6>BINFMT_XFLAT: Process %s:%d received signr %d and should have core dumped <6>BINFMT_XFLAT: Extended flat loader <3>BINFMT_XFLAT: Failed to register binfmt (%d) xFLT <4>XFLATLIB: Unsupported flat version=%d <4>XFLATLIB: xFLT binary not a recognized executable (type=%d) <4>XFLATLIB: xFLT binary not a program file (type=%d) <4>XFLATLIB: xFLT binary not a library (type=%d) <3>XFLATLIB: ERROR: Relocation at 0x%08x invalid -- does not lie in the data segment, size=0x%08lx <3>XFLATLIB: Relocation not performed! <3>XFLATLIB: ERROR: Relocation at 0x%08x invalid -- Improperly aligned <3>XFLATLIB: ERROR: Unknown relocation type=%d <3>XFLATLIB: Failed to map xFLT ISpace, error=%ld <3>XFLATLIB: Failed to allocate DSpace, error=%ld <3>XFLATLIB: Unable to read DSpace, errno %ld ld-xflat.so.1 /usr/lib /lib <3>XFLATLIB: Too many pathes in list (%d) <3>XFLATLIB: Failed to read from "%s" <3>XFLATLIB: Invalid xFLT library header <3>XFLATLIB: Loader pathname name is too long <3>XFLATLIB: Could not find interpreter "%s" <3>XFLATLIB: Failed to initialize for interpreter load <3>XFLATLIB: No program load info provided kernel_version=2.4.19-uc1 GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) GCC: (GNU) 2.96 20000110 (experimental) .symtab .strtab .shstrtab .text .rel.text .fixup .rel.fixup .rodata .rel.rodata __ex_table .rel__ex_table .modinfo .data .rel.data .bss .comment __ksymtab gcc2_compiled. __module_kernel_version xflat_format xflat_load_binary xflat_load_library xflat_core_dump prog_vtbl xflat_prog_map xflat_unmap xflat_alloc xflat_prog_open xflat_prog_read xflat_close ldr_vtbl xflat_ldr_map xflat_ldr_open xflat_ldr_read xflat_ldr_close xflat_init_binfmt xflat_exit_binfmt xflat_reloc lib_path3 lib_path4 default_path_list xflat_get_path_list xflat_read_header xflat_interp_search strcpy open_exec __this_module xflat_adjust_stack_size xflat_init_interpreter __set_personality cleanup_module xflat_verify_program set_binfmt unregister_binfmt init_module xflat_verify_library do_munmap do_mmap_pgoff zone_table strcat ksize fput __up_write xflat_uninit strncmp printk flush_old_exec xflat_load __memzero kernel_read xflat_init register_binfmt xflat_verify_header compute_creds __down_write xflat_init_stack send_sig xflat_default_loader_name strlen xflat_unload cpu_arm7_icache_invalidate_range dispbuf.o VUUUDisplay Driver Copyright (C) 2003 Ingenient Technologies, Inc. 1.2.9 kernel_version=2.4.19-uc1 author=Jay J. Williams description=Display driver for video output %s v%s, %s dispbuf Can't get major number %d. Unable to get IRQ %d for DISPBUF_IRQ Verify error. dispbuf_ioctl: **** ENABLE VD INTERRUPT **** VD IRQ already attached. CCDVD1 Unable to get IRQ %d for DISPBUF_VD_ENABLE VD IRQ already detached. IRQ already attached. IRQ already detached. Undefined ioctl number %d <6> sys_msgsnd error %d history %s v%s Frames In Queue: %d Queue Capacity: %d Display Enable: %d Timer Enable: %d Frame Count: %lu Error Breakdown ================================= Errors 2 - 25mS: %lu Errors 26 - 50mS: %lu Errors 51 - 75mS: %lu Errors 76 - 100mS: %lu Errors > 100mS: %lu Num Error Frames: %lu Max Error: %u mS Error Sum: %lu mS %-20s%-20s%-20s%-15s ===================================================================== InsertionTime(ms) DesiredTime(mS) DisplayTime(mS) Error(mS) %-20lu%-20lu%-20lu%-15d dispbuf_insert_frame: Dropping frame GCC: (GNU) 2.96 20000110 (experimental) .symtab .strtab .shstrtab .text .rel.text .data .rel.data .bss .modinfo .rodata .fixup .rel.fixup __ex_table .rel__ex_table .comment gcc2_compiled. __module_kernel_version desc author version proc_dispbuf_root dispbuf_fops dispbuf_read dispbuf_ioctl dispbuf_open dispbuf_release dispbuf_fasync proc_dispbuf_create s_dispbuf prevIdx dispbuf_task dispbuf_intr_tq history_p history_g dispbuf_msg dispbuf_interrupt proc_dispbuf_remove dispbuf_vd_interrupt frames prevAddr prevSize dispbuf_show_frame dispbuf_history_put proc_dispbuf_display_history dispbuf_history_dump history dispbuf_init printk register_chrdev request_irq decodeWaitQueue dispbuf_cleanup unregister_chrdev free_irq __arch_copy_from_user do_gettimeofday decodeWakeupEvent __this_module fasync_helper __arch_copy_to_user __wake_up schedule_task kill_fasync sys_msgsnd proc_mkdir create_proc_entry remove_proc_entry sprintf strlen dispbuf_osd_set_main_video dispbuf_insert_frame dispbuf_queue_full init_module cleanup_module __module_author __module_description dispbuf_int libpthread-xflat.so.1 xFLT @ #! longjmp __old_sem_trywait pthread_mutex_timedlock waitpid pause pthread_cond_signal __pthread_mutexattr_destroy pthread_rwlockattr_setkind_np __pthread_restart_new pthread_mutexattr_gettype testandset pthread_attr_destroy recv connect pthread_attr_getstacksize __pthread_once __pthread_mutex_lock pthread_getspecific __new_sem_destroy pthread_rwlock_rdlock __pthread_find_self pthread_attr_init pthread_mutexattr_getkind_np pthread_rwlock_init pthread_rwlockattr_getkind_np pthread_exit sem_timedwait pthread_condattr_setpshared __new_sem_init pthread_rwlockattr_setpshared __pthread_mutex_timedlock __pthread_manager_event __fresetlockfiles __pthread_mutexattr_settype __linuxthreads_create_event __libc_current_sigrtmax pthread_condattr_init pthread_attr_getstackaddr pthread_key_delete __old_sem_post _pthread_cleanup_pop __pthread_lock pthread_cancel xflat_pthread_create __pthread_mutexattr_setpshared pthread_mutexattr_destroy __pthread_reset_main_thread pthread_equal __pthread_mutex_init __libc_current_sigrtmin sem_destroy system __udivsi3 siglongjmp pthread_attr_getscope __new_sem_post __pthread_initialize_manager pthread_rwlock_destroy recvfrom sem_wait tcdrain pthread_attr_getguardsize sem_post pthread_testcancel __pthread_manager_sighandler __pthread_attr_getstackaddr __linuxthreads_death_event pthread_rwlock_unlock _pthread_cleanup_pop_restore __pthread_attr_setstacksize pthread_attr_getinheritsched pthread_kill_other_threads_np __pthread_mutexattr_gettype sem_unlink __pthread_kill_other_threads_np __pthread_initialize lseek __pthread_mutexattr_setkind_np __pthread_alt_unlock pthread_detach send pthread_attr_getschedpolicy ftrylockfile pthread_attr_setstackaddr accept __libc_allocate_rtsig pthread_getschedparam pthread_setcancelstate nanosleep __pthread_wait_for_restart_signal __pthread_mutex_unlock __old_sem_init pthread_condattr_destroy write pthread_attr_setscope __pthread_mutex_trylock __pthread_destroy_specifics pthread_mutexattr_setkind_np pthread_cond_broadcast pthread_once __pthread_once_fork_child pthread_attr_setinheritsched __pthread_alt_lock __pthread_manager_adjust_prio __pthread_setconcurrency pthread_setschedparam __pthread_perform_cleanup pthread_key_create __pthread_initialize_minimal __new_sem_wait wait pthread_setconcurrency sem_init __pthread_mutex_destroy __pthread_mutexattr_getkind_np sem_close pthread_kill read pthread_attr_setstacksize sendmsg pthread_rwlock_wrlock pthread_rwlockattr_getpshared sendto funlockfile __old_sem_getvalue pthread_sigmask __pthread_compare_and_swap __pthread_attr_setstackaddr pthread_cond_init pthread_rwlockattr_init fork pthread_mutexattr_getpshared xflat_sigaction sem_trywait __pthread_mutexattr_init pthread_condattr_getpshared _pthread_cleanup_push_defer __div0 open64 pthread_mutexattr_settype pthread_mutexattr_setpshared __flockfile pthread_attr_getdetachstate pthread_mutex_unlock __h_errno_location __vfork __new_sem_trywait msync __pthread_unlock pthread_rwlockattr_destroy sem_open flockfile __pthread_attr_setguardsize __pthread_attr_getguardsize __old_sem_wait vfork __pthread_once_fork_parent pthread_rwlock_trywrlock pthread_rwlock_tryrdlock __linuxthreads_reap_event fsync __pthread_manager __old_sem_destroy __pthread_getconcurrency __pthread_alt_timedlock pread _pthread_cleanup_push pthread_self pthread_setcanceltype __pthread_once_fork_prepare pthread_mutexattr_init pthread_mutex_destroy pthread_mutex_lock __sigaction __new_sem_getvalue sem_getvalue pthread_cond_wait __ftrylockfile __errno_location pthread_attr_setguardsize pthread_mutex_trylock pthread_atfork pthread_cond_destroy pthread_attr_setschedpolicy __pthread_mutexattr_getpshared __funlockfile __pthread_timedsuspend_new pthread_mutex_init __pthread_attr_getstacksize lseek64 open __fork pthread_attr_setschedparam pthread_attr_setdetachstate recvmsg fcntl pthread_join pthread_getconcurrency pthread_cond_timedwait sigwait pwrite close pthread_attr_getschedparam pthread_setspecific raise __libc_tcdrain __libc_pread xflat_on_exit __libc_fsync sysconf sigemptyset geteuid sched_getparam __libc_fcntl __libc_accept getpagesize getpid memcpy __libc_nanosleep malloc sched_setscheduler sched_getscheduler __libc_pwrite __libc_read sigaddset xflat_libc_sigaction __sigsetjmp pipe __libc_lseek64 calloc kill xflat_clone xflat_varptr __libc_open64 sched_get_priority_max __libc_siglongjmp __libc_send sigfillset sched_get_priority_min __libc_pause __getpagesize __libc_close gettimeofday __libc_open memset getppid __libc_recvfrom __libc_system poll __libc_recvmsg __libc_waitpid __libc_fork sigismember __libc_lseek __libc_wait exit sigdelset __libc_sendmsg _exit __libc_recv strlen __libc_write __libc_sendto __libc_msync sched_yield __libc_connect sigsuspend free sigprocmask pt: assertion failed in manager.c 0.9.20 libmserv.so.1 xFLT *(@K *, [ *( K MP4S MP4S DIV3M4S2XVIDWMV3MP4S 33s? RIFFAVI LISThdrlavih00dcmovi idx1 LISTstrhstrlvidsstrf LISTstrhstrlaudsstrf :\ K RIFFAVI LISTmoviidx1 LISThdrl00dcvidsaudsstrl LISTmovi avih LISTstrl LISTstrl strhiavsvids strf strh strf DIV3XVIDDIVX avihX strl vids( auds( WyaJD HyoRX RoyH\ HyoRRoyHT WyaJ *$0K zDdf *$0K *$0K WyaJ gfff gfffpb a42D 32D: WAVEdata /opt/Cadenux/dm270/crossdev/arm-uclinux/lib /lib libpthread-xflat.so print_ftime I2C_readRegs FF_SaveVideoFrame AIC23_mute OSDSetCenter FILEIO_close LCD_Off ServiceAudioEncode CFB_DecFinal AVIUSER_getVideoFrame MP2_isVidQueueFull GIODirSet MP2_isAudQueueFull __cmpdf2 AIC23_setMode AIC23_setTunerMode MSG_Flush FILESERV_seek MP3USER_ConstructorInit __eqdf2 VCAP_EnableInputVideo FF_SaveAudioFrame PE_ResizeSetAddr FILE_open CBC_DecFinal MP4_CBKfileSeek ASFP_GetSectionSizes DisableInterrupt LCD_enable MP2_DecodePktLayer HDI_writeRspToDSP MSG_Init OSDWindowEnable set_LCD_CS_High StopAudioEncode MP3USER_ParserInit __divsf3 ControlLoop GetByte MP2_demux VCAP_SetCapSize AIC23_setHeadPhoneLeftVol ASFC_SetFiletime OSDSetVideoWinParams FILESERV_read SEED_DecInit MAF_AudioStopDec FILESERV_open MAF_ImgDec OSDInit IncrementRingBufIdx __fixsfsi AIC23_init share_init SEED_DecUpdate FF_GetAudioFrame AIC23_sampleRate MP4FFUSER_parserClose FF_ParserInit __gtdf2 ASF_ParserInit OSDEnable SPI_LCD_GPIO_Init MP3USER_SetTimePos HDI_readData FF_ConstructorInit __make_dp AVIC_saveVideoFrame LCD_setBacklight set_LCD_SCL_High ECB_DecFinal __make_fp HDI_writeDataVerify GetVideoTime setHddStatus __subsf3 Main OFB_DecFinal ASFP_GetUserDefinedObject find_stream_type setPwmConfig get_avi_format FILESERV_getFileSize AVIUSER_constructorClose MP2USER_getAudioFrame AUDIOCODEC_setHeadPhoneVolume OSDSetZoom AVIP_init MP2_decodeAudioFrameHeader read_auds_stream ASF_GetFrame GetNextPeekBuffer MAF_Echo MP2_setLastFrameSize MP2_msToTS __floatsidf __ltdf2 FILESERV_close MP2_resetVars WAVUSER_parserClose AVIP_setTimePos AIC23_setHeadPhoneRightVol ASF_SaveAudioFrame DisplayIngenientTypeSizes MAF_AudioStartDec changeVideoResolution VENC_setProgressiveBit __udivsi3 ASFC_Init GIO_makeOutput VCAP_SetMsgQueID FILE_close OSD_setMainVideo2 __lesf2 AUDIOEQ_getSettings VENC_init __fixunsdfsi FF_GetVideoFrame ASF_ParseHdrSection VIDEO_power_on IMG_Rotate MP3USER_ConstructorClose VCAP_GetFrame VCAP_SetCaptureFrameRate FILE_seek SEED_SetAlgInfo AVIC_close SEED_EncInit MP2_tsToMs HDI_loadOverlaysToSDRAM FILEIO_seek MP3_FileRead MAF_AudStartEnc __unpack_d ASF_ParsePacket Audio_ProcessLoadDecRsp __extendsfdf2 PE_ResizeInitJPEG HDI_closeDriver MP4FFUSER_parseInit MP2_GetVidQueueUsage __adddf3 __nesf2 AUDIOCODEC_sampleRate MP2_idleDemuxer MAF_AudioSendDecRsp IMG_HeaderInfo PE_WaitForFinish FF_ParserClose HDI_isr request_codec MSG_Recv sub33Bit ASFC_AddMarker ASFP_GetPAR AIC23_setBypassMode AIC23_record_stop AUDIOCODEC_powerDown PE_ResizeSetSmoothness MP4P_init AUDIOEQ_disable HDI_loadDSPCode set_LCD_SCL_Low ASFC_SetContentDesc read_asf_audio_data AVIC_memQuery CCDTGInit MP2USER_parserInit GetVariableSizeField ASF_CreateHdrSection __unpack_f LCD_On CheckForInterrupt __fixdfsi HDI_initISR GetWord MAF_MPG4_Encode AUDIOCODEC_passThrough MP3_getPlayTime VCAP_Init HDI_readCmdFromDSP QUE_timeLeft AVIUSER_parserInit GIO_write OSDSetFrameMode Audio_offsetTime ASFC_GetSectionSizes __gtsf2 SPI_LCD_Init __lshrdi3 PrevInit __ledf2 MP2_demuxSystem MP4_CBKfileRead VCAP_DeInit __umodsi3 AVIP_setIFramePos MP2_setIFramePos FF_ConstructorClose GIO_enableHotSwap OSDSetZoomAndCenter FILEIO_read VCAP_AttachIRQ __pack_f set_LCD_CS_Low DecodeSignalHandler MP3USER_SaveAudioFrame HDI_init ASFC_SetPAR EnablePassThruVideo HDI_writeData largeResultMult ING_findPattern ASFC_SetUserDefinedObject SPI_Send_Reg_Data16 MP4FFUSER_getAudioFrame AUDIOCODEC_mute checkDecodable HDI_resetDSP WAVUSER_setTimePos IMG_Decode MP3USER_Read MP2USER_setTimePos MP2USER_parserClose MAF_AudioEqUpdate ClearInterrupt find_stream ING_byteAlignment AUDIOEQ_enable SerialMasterTx InitSerial FF_SetTimePos __floatsisf OSDSetVGAMode RC_CheckIfBufferFull VENC_digitalRGB_Enable ProcessVIF OSDGetMainVideoAddr GPIO_Test_Reg MP4FFUSER_convertToMs largeInputDiv OSDSetVideoWinBuffer MAF_MPG4_DecodeInit __eqsf2 SEED_Encrypt MP3_getHeaderInfo VCAP_SetMsgType WAVUSER_getAudioFrame AVIP_peekNextAudFrame ServiceVideoEncode checkDRM MP2_setTimePos __fpcmp_parts_d transResize_func OSDSetMainVideo MP2_getPackPos __negdf2 QUE_addFrame WriteFileInfo OSD_calcZoomAndCenter2 MP4FFUSER_setTimePos delay1ms ASF_IndexBufInit GIO_read __divdf3 __negsf2 HDI_detachIRQ MAF_AudioEqFFTEnable ING_getBits __muldf3 MAF_MPG4_DecodeGetRsp EnableInterrupt HDI_readRspFromDSP set_LCD_GPIO_High QUE_getAudioFrame MP2_GetAudQueueUsage MAF_ImgGetHeaderInfo PE_setPosInfo CCDC_init SPI_Send_Index_Data16 MSG_GetID __cmpsf2 MP2_setPackPos MP2_demuxM2Video StartAudioDecode SPI_Send_Byte ASFC_MarkerSecInit ING_setLinuxTime MemInitStatic GeneralEncDec ASFUSER_SaveAudioFrame __div0 ASFC_MemQuery __ltsf2 MP3_ParseHeader __truncdfsf2 GPIO_delay MSG_NoWaitRecv RC_CalcKbpsAdjustment HDI_openDriver GPIO_Test_Index AVIUSER_constructorInit VCAP_GetSnapshot __divsi3 read_asf_video_data __mulsf3 MP2_findVOP ASFP_SetTimePos ASFUSER_SaveVideoFrame read_asf_maximum_bitrate DecrementRingBufIdx MAF_MPG4_EncodeInit SEED_Decrypt ASFUSER_ConstructorInit AVIC_init MP4FFUSER_getVideoFrame __nedf2 convertToNs AUDIOEQ_setBandGains Error FILE_write AVIUSER_getAudioFrame ChangeToCapital MP4P_setTimePos VENC_setColorBars __gesf2 I2C_readReg GPIO_delay_cnt StopAudioDecode AIC23_passThrough SEED_DecFinal AVIUSER_setTimePos RC_UpdateBufferOccupancy ASF_CreateIndexSection SetVideoDecodePosInfo HDI_peekRspFromDSP ASF_SaveVideoFrame LCD_init2 WAVUSER_read WAVUSER_parserInit MP4P_getFrame GIOSet VCAP_SetMsgFlag OSDGetVGAMode OSDSetMainVideoPos AVIP_memQuery AIC23_setHeadPhoneVol QUE_setAudioRate clearFileInfo MAF_PrescaleAudio VENC_LCD_Init MP2_processVOPAroundPivot AIC23_setRecLeval MAF_MPG4_Decode SEED_KeySchedule QueueEventPush I2C_init QUE_clearAllQueues read_avih M2D_init I2C_writeReg MSG_Send MAF_AudLoadDec LCD_power_on AUDIOEQ_setSampleRate WaitForInterrupt AVIUSER_saveVideoFrame CLOCK_init FILESERV_init AVIC_saveAudioFrame AIC23_setLineVolume SetActiveDisplay AVIUSER_saveAudioFrame ASFUSER_GetVideoFrame OSD_videoEnable VCAP_DetachIRQ read_vids_stream ASFUSER_SetTimePos GetDword VCAP_isr RC_Init MP2USER_getVideoFrame FILESERV_tell FILEIO_open MP3_getTotalTime GetMsCount VENC_VID_Enable QUE_init MP2_demuxIdentify print_time StartAudioEncode OSDGetPAL SEED_EncUpdate MemDisplayConfig AVIC_createHdrSection OSD_setPosInfo set_LCD_SDA_High ASFUSER_ParseInit set_LCD_SDA_Low __fixunssfsi QUE_FullQueues __fpcmp_parts_f AVIP_getNextFrame ServiceAudioDecode initInterrupts __gedf2 AVIUSER_parserClose CBK_FileSeek MAF_SetOvlyAddr QUE_getVideoFrame HDI_readRspFromDSPIRQ ASFUSER_ParserClose HDI_writeCmdToDSP VCAP_ResetCapture PE_ResizeInit MP4P_setIFramePos AIC23_powerUp ServiceVideoDecode PE_ResizeEnable __subdf3 SetPriorityLevel I2C_writeRegs AUDIOCODEC_init ASFP_MemQuery MAF_AudioStopEnc ASFUSER_ConstructorClose GIO_makeInput get_asf_format __addsf3 MAF_ImgRotate MP3USER_ParserClose checkDRM_file CBK_FileWrite __pack_d AIC23_powerDown MP3USER_GetAudioFrame HDI_initFlags ASFUSER_GetAudioFrame HDI_attachIRQ ING_getBitsInit strcpy ioctl printf strerror pthread_attr_init usleep getpid msgrcv shmat setitimer xflat_pthread_create malloc sleep sched_setscheduler settimeofday lseek mmap strrchr write fstat kill shmget read strncpy sync sched_get_priority_max memcmp sched_get_priority_min xflat_sigaction msgsnd strdup gettimeofday time msgctl llseek strcmp pthread_mutex_unlock sprintf ftime pthread_mutex_lock __errno_location exit atoi pthread_attr_setschedpolicy gmtime pthread_mutex_init strlen open pthread_attr_setschedparam sched_yield msgget close free @ #! bB? 0B2 0 @ #! @ c! Se iMovSC _\D+ _\D+ Se@ _\D+P iMovSC@R _\D+@ _\D+ Se@ _\D+ _\D+Can't find ASF_File_Properties_Object GUID Error: Can't lseek Error: Can't read WAVEFORMATEX size Can't find ASF_Audio_Media GUID Error: Can't read BITMAPINFOHEADER size Error: not read Can't read. offset(%d) Error: not open %s Error: Can't read asf video data Error: Can't read asf audio data Error: Can't read asf max bit rate %.4s Error: Can't lseek Error: Can't read 4 byte Error: not find avih Error: Can't read MainAVIHeader size Error: Can't read hdrl size Error: Can't read avih size Error: Can't read strl Error: Can't read fccType Error: Not find strf : %.4s Error: Can't find %.4s Error: Can't read AVIStreamHeader size Error: Can't read BITMAPINFO size Error: Can't read WAVEFORMATEX size Error: not open %s Error: Can't get file state Error: Can't read avi header data Error: Can't read avi video data Error: Can't read avi audio data /dev/hda Serial # = %.20s /mnt/Root/iRiverSys/system Error read iRiverSys/system[%s] fd = 0 %02X%02X%s =========> [%s] *~( *~( ``H` ``H` ``H` ``H` ``H` ``H` w(6f w(6f wjVE wjWq wjYE wjZ q wjZf TV\NZNt IVSPS PRPN@ TS\O NVVt VDNr XpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXp pBp#p p `AhAh!h!h `APAP XpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXpXp qaqAq hahahAhAh!h!h!a PaPaP !0!0A@ wj6t okhX ouhX 6'as 5 $o $ 7 I \ o i}j k r~s%t xay z H"IFI I+IRI I I!I 3I7I;I?IAICIDIEI ]I^I`IhIxI J J!J CJDJFJNJ^JnJ~J K K!K#K%K'K FKVKfKvK VLWL[LkL{L M"M&M*M,M.M0M4M6M8M:MMBMFMJMLMPMTMXMZM\M`MdMhMlMpMtMxM|M~M O!O#O'O+O/O3O5O7O;O?OAOCOEOIOKOMOOOSOWO[O_OcOgOkOoOsOuOwOyO}O \P]PaPqP Q#Q%Q'Q QGQWQgQwQ 6RFRVRfRvR~R S"S*S2SBSRSVSZS^SfShSxS *i#u }&_^ }&Av MAvK Av_^ 0AvAv 0AvAv e}& 0AvAv 0AvAv Av_^ MAvK 0AvAv 0AvAv MyV^^ e^^yV MyV^^ e^^yV 3Q?L| 6?Lc 3Q(% (%3Q (%(% (%3Q V9D pT9t ol9] ol9] uT=6 uU=6 { % =~1? =~1? h}X *~( *~( *~( *~( (~( ``H` ``H` ``H` ``H` ``H` ``H` @%H$H#H!H!P P X X!XP`Q`R` P"XS`U` H&X'X\`]`^`_` @%H$H!P P P!XP` ("HR` @!H H H"X#XV`W` P$X%X&X'XX`Y`Z`[`\`]`^`_` 0=0= v t N Vh 5 $o VDNr (}) * |rz 57b] M{O8Q t!w"z +Gx: }&_^ }&Av MAvK Av_^ 0AvAv 0AvAv e}& 0AvAv 0AvAv Av_^ MAvK 0AvAv 0AvAv MyV^^ e^^yV MyV^^ e^^yV 3Q?L| 6?Lc 3Q(% (%3Q (%(% (%3Q VnBnDnFnGn anenfnhnxn o$o4oDoHoLoNoOoPoRoToVo wo{o p,pr@rDrHrLrNrPrRrTrVrXrZr\r^r`rbrdrfrhrjrlrnrprrrtrvrxr -s=sMs]sms}s t!t%t)t+t-t/t3t5t7t;t=tAtEtItKtOtQtUtWtYt[t_tatctgtitktotqtstutwtyt{t}t u'u7uGuWu_ugukumunuousuwu{u}u uevgvivkvmvovqvsvuv uwvyv{v v-v5v=vEvMvUv}v w,w4w8w:w;wx@xBxFxHxJxpw wNxPxRx cxdxhxlxpxrxsx *i#u l1ys w T wtRr JWHNh 7fLp '&)(4*6587:9DCFEHGJITSVUXWZYdcfehgjitsvuxwzy Qqa" ('*)6587:9DCFEHGJITSVUXWZYdcfehgjitsvuxwzy 0Bvnj Z=Kr Z!!& }Bvnj Bvnj nr p |4W@ LQLO2 `BM0 VDNr w ,t 2O-b( O!Ge? G'@-9 2k-{( & = T k #X$0% +',U- 7N97;@=k? lNkRWXV `NRVTW `N\V@ N`Vt XN\V NNLq 4VXN O^Vt XV4N mmXV XN^V _m^V xmXV XNXV *E6N mXV4P WNVXO@ fp"q r,V:o 4n8N VV0N 8W0V ~r,V mr0V t,V@o 4n8N V8N" VR>N@ .NBV0N 8W0V VOV8W 0N4q W V V$W V$W N$V@ V$W N$V@ R&N@ N(W N$V &N(N "N V N*Vt N*Vt .W&O W.O,W"O W,O4W(O W4O2W2N$O6 ?g9- g"@r l1ys w T wtRr JWHNh 7fLp '&)(4*6587:9DCFEHGJITSVUXWZYdcfehgjitsvuxwzy Qqa" ('*)6587:9DCFEHGJITSVUXWZYdcfehgjitsvuxwzy 0Bvnj Z=Kr Z!!& }Bvnj Bvnj oE/C oE/C oE/C oE/C oE/C oE/C nr p |4W@ LQLO2 `BM0 laKs VDNr V*)t vd!o) V")t 0)D) 2O-b( O!Ge? G'@-9 2k-{( o)o)& & = T k #X$0% +',U- 7N97;@=k? X)X) qv/u/ 5 $o p"p^o l#lJklj ZcYBX ShR3Q EzD%C Q&?ff3?33f?ff 4wJw`w `1k$@N x#@K =~1? (x'x&x%x$x#x"x!x xNxMxLxKxJxIxHx jBjCi hGhFh 1B0A1AC @ X0gPeHiPQ@ +A+As!? u!t!g! #Y+ 4e+ UU%IDD @@@ @ IAUUff%I @@@ @ q<:=: 1:L 0:O w$: N2:t r<:p r':t q<:=: s7:t DNFN DNFW BVJN IDSRS FVDV RRRN@ BSJO wxAt & h? 5 $o *i#u 3Q?L| 6?Lc 3Q(% (%3Q (%(% (%3Q V!A l!n!p D`L@I @ B@\ F@J @ B D@H` D`L 9 @ B`d @@D@{ B`J@ @ B B D @ B B`J@, @ B 6 D F h J`R w @@D F H@ H`P@ T@X@ D@H@. @`H`P`X` @@D F@J@N@ F@J@N ! P R ' T`\`d`l@p@I D@H@L h`p`x` @`H`P@T@X Z` d@h@l / n`v < @`H`P`X@\@` p H@L@P@T V X Z \ ^ H@L@P@ T V @@D F H J L@P@T@X@ \ ^ @@D J@N@R@V B@F@J@N@R T V > @ B D F@L J@N@R@V Z X Z _ ^ ` m @@D@H@L@P@T V X d@h@l n p r B D J@N@R@V@Z@^ ` @ B D F H J L N@R@V@ Z@^@b@f h j l ) @ B 6 D@H@L@P@K T@X@\@` b d f ` j l n p 2 @@D@H@L@P@T V X Z ` b @@D@H@L@P X Z \ D@H@L@P@T@X@\@` b d f h j l@p r t v x z |@. @@D@H@L@P@T@X@\@` b Z d f h g @@D@~ H@L@P@T@X@\@`@d f h j l B D F H J L N D@H@L@P@T@X@\@`@d f h j l n @ B D F H J L R@V@Z@^@b@f@ I#D# !C" g&BV Y" : c*C#G# JA!E&D B%Ae %B1A f2B* E#A; DEA=A C$B4A g5hM mtut}t r=lE |MlU /-/m s50=jMj% :E}%: =u}}} t~\x {$n< C\rl {6~\ |{TrLt -~.| [z;t DMJUJ % = UZ -OU\ exmxux P-{m = U ] r-umu B%R5"M"}" "5bM -$5$El} m+}+ eezUT=*uz dM/e/m/ =}Ed 8-8-;m}Ud ,bTt; +Sh; .b|" !vQ| ky~) })rY CBv2 !r ` ;J}: =Rtj{ d * '"lz *&2& |*bJK W \5 l6x6 Z{6z " 2h MB}J 7J{R LJnJf2\b} }M~<~ bt** zw:6 qj}" D ,1v izyzq f2Jq [9ta A)ty X { 6:R*6 /2b2Hb $"jb{ 2dBp VDNr p?/t p?/t p?/t /dev/event_queuemod /dev/event_queuehdd ===> MSERV : %d Queue open error ===> MSERV : %d Queue SEND [%d][%x] shmget error shmat error ControlLoop: Error while trying to register signal SIGALRM. /mnt/ramdisk/sighdd_id M09.05.56 Audio Equalizer Settings: ========================= EQ Enabled: %u Equalizer Band Settings 60 Hz %d dB 250 Hz %d dB 1000 Hz %d dB 4000 Hz %d dB 12000 Hz %d dB DIVX divx MPEG mpeg /dev/dsp_intr /dev/i2c_dm270mod /dev/dispbuf CLOCK_init: Error(%d) while opening DISPBUF driver. err = %d DisplayIngenientTypeSizes:BOOL = %d DisplayIngenientTypeSizes:UINT8 = %d DisplayIngenientTypeSizes:UINT16 = %d DisplayIngenientTypeSizes:UINT32 = %d DisplayIngenientTypeSizes:INT8 = %d DisplayIngenientTypeSizes:INT16 = %d DisplayIngenientTypeSizes:INT32 = %d DisplayIngenientTypeSizes:INT64 = %d DisplayIngenientTypeSizes:USHORT = %d soun vide ga01 ga02 mp4a esds gv01 gv02 avc1 mp4v avcC moov mvhd trak tkhd mdia mdhd hdlr minf vmhd smhd stbl stsd stsz stsc stco stss stts ERROR(%s) :::: %s SEED_KeySchedule() returns. /dev/vif_intr CODEC : changeVideoResolution DS%d `S lt %\QM `cC#( (D@D xsK; .pp@0 6tpD4 psC3 'prB2 ``@ PP@ 7XRJ xpH8 `aA! 4@AA |qM= =trF6,# "lbN. haI)|pL< >d`D$ .HCK !hcK+dbF& 3|rN> xrJ:DCG 'DAE | aE%d0 pL<| P1 98" aI)h ;8BJ %$!M C#`c (( D K;xs @0pp D4tp C3ps B2pr @ ``@ H8xp A!`a PRM=|q F6tr N.lb LAI)haL<|p D$d` .,"K ! !K+hcF&db N>|r J:xrG <<<0A1pq E5tq I HA 981G'dc L,l` O/lc -,!@ H(h`O?|s TRG7ts +(#E%da M-laO :82H B"`b )(! I9xq J*hb ``@ D@D/lcO+hcK "`bB303 )(! HCK/ ,l`L( DAE! LBN6 &dbF:xrJ'$# 2prB 3psC'dcG, TSG. =|qM *hbJ1 (h`H1pqA !`aA> ;xsK \PL" #`cC# # .lbN XRJ2 HAI8xpH 0pp@5tqE?|sO541 $d`D-laM 4tpD 6trF \RN) H@H9xqI \SO7tsG TPD2 DBF- PRB+ >|rN %daE<<<0 <|pL PP@981 &$" )haI HBJ7 CTR_FATAL_ERROR CTR_INVALID_USERKEYLEN CTR_PAD_CHECK_ERROR CTR_DATA_LEN_ERROR CTR_CIPHER_LEN_ERROR CTR_USAGE_ERROR CTR_KEYFILE_ERROR ld-xflat.so.1 xFLT dlopen dlsym dlmodule dlfcncall /lib/ld-xflat.so.1 LDSO: ERROR: Could not load shared libraries needed by "%s" LDSO: WARN: Exporter of symbol "%s" needed by "%s" not found LDSO: WARN: Module "%s" contains uresolved symbols LDSO: ERROR: Invalid xFLT Header, cannot load program /usr/lib /lib LDSO: ERROR: Seek to begninning of file, offset=%ld LDSO: ERROR: %s: mmap failed LDSO: ERROR: Seek to %ld failed, offset=%ld LDSO: ERROR: Read only %ld of %ld bytes from fd=%d, offset=%ld LDSO: ERROR: Invalid binary format LDSO: ERROR: Failed to initialize xflat library LDSO: ERROR: Failed to load xFLT binary LDSO: ERROR: Could not allocate module structure LDSO: ERROR: Too many pathes in list (%d) LDSO: ERROR: Too many library filenames in list (%d) LDSO: WARN: Could not find "%s" LDSO: ERROR: Could not load "%s" LDSO: ERROR: Could not locate caller's module description LDSO: ERROR: Could not load "%s" LDSO: ERROR: Could not libraries needed by load "%s" LDSO: ERROR: Missing handle or symbol LDSO: ERROR: Null value received in function description (overflow) (null) LDSO: ERROR: Could not find exporter of symbol "%s" XFLATLIB: ERROR: Relocation at 0x%08x invalid -- does not lie in the data segment, size=0x%08lx XFLATLIB: Relocation not performed! XFLATLIB: ERROR: Relocation at 0x%08x invalid -- Improperly aligned XFLATLIB: ERROR: Unknown relocation type=%d XFLATLIB: Failed to map xFLT ISpace, error=%ld XFLATLIB: Failed to allocate DSpace, error=%ld XFLATLIB: Unable to read DSpace, errno %ld xFLT LDSO: WARN: Unsupported flat version=%d LDSO: WARN: xFLT binary not a recognized executable (type=%d) LDSO: WARN: xFLT binary not a program file (type=%d) LDSO: WARN: xFLT binary not a library (type=%d) libc-xflat.so libc-xflat.so.1 v=libmserv.so libmserv.so.1 libpthread-xflat.so libpthread-xflat.so.1 libc-xflat.so.1 xFLT gfff Qgfff gfff @ #! bB? 0B2 0 @ c! @ #! @ c! __read_etc_hosts_r longjmp __libc_tcdrain stpcpy putchar tsearch setgrent __create_module __libc_pread putw chroot strcpy asctime __syscall_getpriority setrlimit64 unsetenv __cmpdf2 __socketcall mkstemp64 xflat_on_exit bcmp setjmp waitpid __longjmp tmpfile __eqdf2 __libc_fsync __open_nameservers getrlimit pause ioctl writev pthread_cond_signal get_kernel_syms siginterrupt scandir64 vscanf putspent if_indextoname getservent strtok_r getutid getgid __getpid popen sysconf printf vsprintf random getspnam_r utime getdtablesize lrand48_r __fsetlocking _obstack_memory_used cfgetospeed sethostent __length_question setservent pthread_mutexattr_gettype getlogin putc_unlocked pthread_attr_destroy _stdio_fwrite recv connect __encode_question lockf64 ungetc tcgetsid getservbyname_r __encode_header pthread_attr_getstacksize __pthread_once getutline sigemptyset __fbufsize utimes __pthread_return_void __divsf3 pthread_rwlock_rdlock __sigdelset shmctl strerror fpathconf memrchr geteuid strndup inet_pton __getdents pthread_attr_init stat64 __xpg_basename sigpause memmove hsearch pthread_rwlock_init pclose pthread_exit getopt_long __fpending sighold endnetent snprintf syscall _getopt_internal pathconf __fixsfsi munmap fileno_unlocked ulckpwdf sched_getparam _uintmaxtostr _longjmp getttyent mknod ftello64 __gtdf2 __libc_fcntl atol pthread_rwlockattr_setpshared _syslog __write getc_unlocked getgrgid times statfs64 nrand48 __syscall_fstat strtoimax getprotobynumber __add_to_environ alphasort64 getenv fchmod pwrite64 __make_dp setfsuid getspuid_r strtold getegid isblank setlinebuf setpriority labs getpriority gets __rt_sigsuspend __libc_accept __make_fp memmem __heap_alloc_at getresuid bsearch sigrelse isxupper usleep __subsf3 execve getprotobyname __libc_current_sigrtmax vsscanf semget __libc_pwrite64 pthread_condattr_init getpagesize getpid erand48_r pthread_attr_getstackaddr hsearch_r qsort fchown truncate setstate_r fscanf fgets dirname __libc_getpid getnetent __getdelim __heap_free error_at_line fgetspent hcreate fcntl64 getpw getrlimit64 getc fchdir msgrcv shmat re_search_2 memcpy setitimer setvbuf execl __syscall_creat seekdir sched_rr_get_interval __floatsidf glob perror pthread_mutexattr_destroy __ltdf2 swab creat readlink _stdio_lseek pthread_equal __fwritable _ppfs_init _stdio_adjpos puts __libc_nanosleep dup2 __libc_current_sigrtmin islower tcflush execle __fpurge getpass getuid tolower tcsendbreak rewinddir semctl drand48_r system __open_etc_hosts feof hasmntopt __encode_packet _obstack_begin_1 malloc remove __udivsi3 isatty cfgetispeed confstr _stdio_fsfopen endpwent siglongjmp pthread_attr_getscope sleep sched_setscheduler __strerror_r __asprintf sysinfo strtoll vsnprintf __lesf2 __dns_lookup pthread_rwlock_destroy open_memstream __sgetspent_r recvfrom tcdrain strtoumax statfs pivot_root __libc_longjmp random_r strtoul getutent sched_getscheduler getprotoent_r _cs_close readdir_r mktemp modify_ldt ispunct settimeofday gethostbyaddr gethostbyname_r _obstack_newchunk pthread_rwlock_unlock sigaltstack rmdir adjtime __adjtimex sgetspent_r socket select init_module readdir __flbf fstatfs lchown re_match setgroups delete_module fopencookie clearerr_unlocked isspace pthread_attr_getinheritsched __unpack_d hcreate_r fgetspent_r mempcpy fflush creat64 __libc_pwrite __getgrent __extendsfdf2 __libc_read ftruncate __adddf3 __nesf2 fgetgrent realpath putenv getservent_r lseek sigaddset clearenv chown mmap xflat_libc_sigaction strncasecmp _glibc_strerror_r bzero __freadable setpgid send getdomainname freeaddrinfo setbuffer abort getpt endprotoent nrand48_r xflat_signal getservbyport_r pthread_attr_getschedpolicy _fcntl64 __sigjmp_save __syscall_mknod gmtime_r chmod getnameinfo ftrylockfile srandom_r fstat64 isxdigit tdelete alarm __freading acct strtoq pthread_attr_setstackaddr strtol __sigsetjmp pipe __libc_lseek64 fsetpos getpgrp strnlen rawmemchr getnetbyaddr capget uname accept __libc_allocate_rtsig pthread_getschedparam __ipc cfsetispeed utmpname __libc_pread64 __unpack_f hdestroy_r rename __sigaddset __syscall_ioctl pthread_setcancelstate pthread_getcancelstate setttyent strrchr basename nanosleep _obstack_begin __fixdfsi calloc re_set_registers imaxabs __modify_ldt wait4 setrlimit inet_lnaof strtod rindex gai_strerror inet_makeaddr setprotoent sendfile statvfs64 lckpwdf pthread_condattr_destroy pthread_attr_setscope write inet_netof ioperm _newselect atof __gtsf2 sysctl fdatasync fstat fprintf __lshrdi3 jrand48_r __error_at_line kill fputs_unlocked setpwent __ledf2 ctime strcat re_compile_pattern bind fgetpos64 getspent_r rand_r getmntent_r getprotoent __umodsi3 xflat_clone if_nameindex inet_addr readv xflat_atexit truncate64 vprintf __rt_sigpending umount2 __getspent_r mkfifo getprotobyname_r pthread_cond_broadcast if_nametoindex madvise _stdlib_strto_ll reboot chdir sigwaitinfo pthread_attr_setinheritsched xflat_varptr initgroups __res_close __pack_f fseeko setregid sigignore shmdt fstatvfs setsockopt endgrent fseek mremap pthread_setschedparam ctermid wait3 tmpnam_r nl_langinfo shmget getdelim setstate __decode_dotted cfsetospeed memccpy uselib __strchrnul memchr __pthread_initialize_minimal swapoff tfind wait re_match_2 __libc_open64 umask scandir lfind pthread_setconcurrency gethostbyname2_r dprintf mktime fgetpwent_r strcasestr lstat ferror strstr unlockpt __error rand getspuid __close_nameservers flock ftello setgid psignal read dirfd endutent __floatsisf setspent __xstat64_conv get_current_dir_name getspnam openlog pread64 __decode_header pthread_attr_setstacksize sendmsg strlcpy strcoll closelog isupper strncmp query_module sigorset alphasort getusershell pthread_rwlock_wrlock sethostname __cmsg_nxthdr pthread_rwlockattr_getpshared setpgrp strncpy unlink getrusage sync setenv freopen64 __eqsf2 __gen_tempname strcasecmp sendto sched_get_priority_max funlockfile isascii execvep realloc addmntent __libc_siglongjmp fcloseall __ugetrlimit __fpcmp_parts_d __libc_send tmpfile64 readdir64 pthread_cond_init bcopy remque strtok __negdf2 __decode_question sigfillset memcmp listen sched_get_priority_min pthread_rwlockattr_init fdopen fork sigset sscanf execv setmntent statvfs isalpha getgrent lstat64 __divdf3 __negsf2 xflat_sigaction __decode_packet setresuid strncat execlp __libc_pause msgsnd __uClibc_init setdomainname __muldf3 re_comp endmntent _store_inttype srand48 __res_init __length_dotted killpg __getpagesize fread __syscall_fstat64 getprotobynumber_r ttyname_r outb inet_network _stdio_fread __uClibc_main __ptrace getlogin_r __libc_close strdup inet_aton iopl ether_ntoa_r _obstack_allocated_p strtoull __cmpsf2 endhostent regcomp index mrand48_r __sigismember symlink gettimeofday fopen asctime_r getopt setreuid __libc_open localtime memset __encode_answer fnmatch cfmakeraw siggetmask lockf __div0 getsid ftell srand sethostid strxfrm __ltsf2 strlcat clearerr initstate fclose grantpt __syscall_rt_sigaction open64 __truncdfsf2 getchar __xstat_conv inet_ntoa fgetpwent pthread_mutexattr_settype getppid tcgetattr gethostbyaddr_r getservbyport ptrace regexec endusershell __libc_recvfrom time opendir getgroups __libc_system isgraph msgctl poll sigtimedwait bdflush ftok fgetpos syslog isalnum ptsname getitimer hdestroy __form_query tmpnam seteuid isprint mrand48 putc __divsi3 getopt_long_only endttyent pthread_attr_getdetachstate getpwent_r llseek __get_hosts_byname_r mount __mulsf3 __stdio_init_mutex nice _time_mktime getpwuid_r herror __libc_recvmsg fread_unlocked _susv3_strerror_r strcmp shutdown fsetpos64 pthread_mutex_unlock __syscall_stat64 __default_sa_restorer lrand48 ttyname register_printf_function getpwuid isxlower __h_errno_location swapon sigblock getcwd __nedf2 gethostbyname strsignal getpwnam _stdio_fopen endspent __syscall_lstat getservbyname fgetc gethostname memalign sprintf ether_aton_r __mempcpy __default_rt_sa_restorer asprintf msync difftime strtof insque __libc_waitpid toascii __gesf2 strcspn pthread_rwlockattr_destroy __getpwent_r flockfile setlocale getpeername getsubopt _stdio_term cfsetspeed scanf regerror __decode_answer ctime_r _cs_read umount pututline mmap64 mkstemp getttynam error erand48 fstatvfs64 vfork setlogmask srandom obstack_free readdir64_r _ppfs_setargs strsep fstatfs64 __libc_fork getpwnam_r re_compile_fastmap pthread_rwlock_trywrlock putchar_unlocked sched_setparam ldiv pthread_rwlock_tryrdlock sigismember timelocal _dtostr fsync valloc fputc __pthread_return_0 __libc_lseek getspent feof_unlocked getchar_unlocked pread pthread_self pthread_setcanceltype getsockopt pthread_mutexattr_init globfree hstrerror localtime_r getaddrinfo re_set_syntax socketpair setresgid __libc_wait outw fflush_unlocked twalk strftime localeconv fwrite_unlocked ftime inet_ntoa_r stat sendfile64 isdigit mkdtemp stpncpy getmntent fwrite quotactl dysize __drand48_iterate outl access setfsgid __path_search ether_aton pthread_mutex_destroy lsearch vfscanf strptime rewind strtouq _ppfs_prepargs freopen re_search _sysctl __pthread_return_1 fgetc_unlocked __sysconf _cs_write initstate_r pthread_mutex_lock drand48 tcgetpgrp if_freenameindex sigandset pthread_cond_wait __syscall_stat _flushlbf gethostent getnetbyname __errno_location link _stdlib_strto_l _obstack_free semop exit _stdio_init _reboot ether_ntoa llabs __modsi3 stime __heap_alloc klogctl sigdelset setbuf inet_ntop pthread_mutex_trylock getresgid getgrnam gethostbyname2 __libc_sendmsg gcvt atoi globfree64 iscntrl ferror_unlocked pthread_cond_destroy fileno _stdio_fdout vsyslog pthread_attr_setschedpolicy _setjmp fgets_unlocked getline __fpcmp_parts_f endservent _exit __get_hosts_byaddr_r getpwent gmtime strspn __libc_recv __getdents64 _mmap tempnam pthread_mutex_init strlen lseek64 __uClibc_start_main sigpending open vhangup toupper __rt_sigprocmask __libc_write __gedf2 _ppfs_parsespec atoll clock getw vdprintf __assert ptsname_r regfree __libc_sendto updwtmp strchr setutent fputs adjtimex execvp pthread_attr_setschedparam setsid putpwent setegid mprotect capset __sigpause closedir __libc_msync __encode_dotted setnetent create_module __syscall_lstat64 _time_t2tm setusershell vasprintf __subdf3 pthread_attr_setdetachstate recvmsg fputc_unlocked strchrnul __fwriting fcntl tzset _fcntl sched_yield getpgid setuid pthread_getconcurrency jrand48 __rt_sigtimedwait gethostid fseeko64 pthread_cond_timedwait re_exec tcsetattr __res_query sigisemptyset mkdir sigsetmask msgget sgetspent pwrite close parse_printf_format __addsf3 __libc_connect pthread_attr_getschedparam glob64 srand48_r telldir __pack_d fmemopen vfprintf strpbrk tcsetpgrp sigsuspend _load_inttype raise tcflow free sigprocmask getsockname fopen64 ftruncate64 main %s: %d: %s: Assertion `%s' failed. ?function? file /tmp %.*s/%.*sXXXXXX abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 XXXXXX %s %s %s %s %d %d syslog <%d>%.15s [%d] [truncated] /dev/console /dev/log SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??? ??? 0 ???? ""##$$$%%&& ???? %m/%d/%y %Y-%m-%d %H:%M %H:%M:%S ()*+ PcXc, `5a5`c` %m/%d/%y %Y-%m-%d %H:%M %H:%M:%S ()*+ ,M4.1.0,M10.5.0 /etc/TZ /var/run/utmp POSIX $VVZ $(,048e$i2c21 mtd3 i2c1 i2c_dm270mod e@sdb11 sdc8 2yusbevm2mod sdc13 gio23 sdc15 afcjmmca1 wMqtty5 f>c:i2c30 e8sda2 xccd_control Zdsp_intr i2c5 gio9 [xL[ttyp0 bMsdc14 a VIgio17 sdc7 null sdd2 sda8 Rkcdrom i2c6 h UUgio20 \`Lmtd0 pmplockmod sdd12 i2c16 [wJhttyS0 i2c27 T}gio7 Zispi1 pmumod venc_oki sdb14 ttyp1 sdb9 sdb3 S{gio8 Rgdsp2 s@matrixkeymod i2c25 sdb12 gio10 mtd2 sda9 ^dsdc4 ]2sdd5 powerkeymod gio28 event_queuemod zero i2c20 SUtimer1 prev_eng _*hda1 i2c9 gio21 i2c2 Pxclockc tty0 [-sdd14 PKgio0 >\+i2c0 i2c12 gio14 i2c8 sda10 [hsdc2 Z*sdd9 slidekeymod wE'tty2 i2c18 i2c11 timer0 sda4 PStimer3 Z@sdc6 sdd8 \*sda1 usbdevicemod i2c19 i2c3 b>Y|i2c14 Y@sdc11 c>Y=i2c13 sdc1 i2c26 ttyS1 sda15 tty3 fX;mmca timer2 vB[tty tty7 console Vzsdd1 Y}sda14 a KNgio27 d K1gio24 i2c15 i2c29 sda13 sdb2 gio3 d>Vsi2c22 w@_tty6 XJfda1 J!gio5 qevent_queuehddmod gio18 sda12 T|sdd VR]i2c28 sdd7 sdd11 sdc12 sdc5 sdd10 sda6 [dispbuf QJsdc9 R@sdb6 >Q3i2c4 gio11 sdb4 ptmx gio4 watchdog f Dngio12 sdd15 _ D'gio19 sdb10 sdb7 dsp1 sda5 jdburst_compress BUdsp3 _>O)i2c17 i2c24 i2c23 ram0 i2c10 gio26 c B`gio25 H[spi0 P6sda3 sdb5 gio29 ptyp1 sda7 Mqsdc10 vif_intr N6.& @80( 91)! ;3+# =5-% ?7/' 91)! :2*" ;3+# <4,$?7/' >6.& =5-% (3-!0,1'8"5.*2$ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz QZ^& syslog <%d>%.15s [%d] [truncated] /dev/console /dev/log ""##$$$%%&& ,M4.1.0,M10.5.0 /etc/TZ /var/run/utmp /etc/passwd /etc/passwd /etc/passwd /etc/group /etc/group %s%s%m (nil) (null) %.*s %0*d %.*d %c%+.2d Unknown error Success Operation not permitted No such file or directory No such process Interrupted system call Input/output error No such device or address Argument list too long Exec format error Bad file descriptor No child processes Resource temporarily unavailable Cannot allocate memory Permission denied Bad address Block device required Device or resource busy File exists Invalid cross-device link No such device Not a directory Is a directory Invalid argument Too many open files in system Too many open files Inappropriate ioctl for device Text file busy File too large No space left on device Illegal seek Read-only file system Too many links Broken pipe Numerical argument out of domain Numerical result out of range Resource deadlock avoided File name too long No locks available Function not implemented Directory not empty Too many levels of symbolic links No message of desired type Identifier removed Channel number out of range Level 2 not synchronized Level 3 halted Level 3 reset Link number out of range Protocol driver not attached No CSI structure available Level 2 halted Invalid exchange Invalid request descriptor Exchange full No anode Invalid request code Invalid slot Bad font file format Device not a stream No data available Timer expired Out of streams resources Machine is not on the network Package not installed Object is remote Link has been severed Advertise error Srmount error Communication error on send Protocol error Multihop attempted RFS specific error Bad message Value too large for defined data type Name not unique on network File descriptor in bad state Remote address changed Can not access a needed shared library Accessing a corrupted shared library .lib section in a.out corrupted Attempting to link in too many shared libraries Cannot exec a shared library directly Invalid or incomplete multibyte or wide character Interrupted system call should be restarted Streams pipe error Too many users Socket operation on non-socket Destination address required Message too long Protocol wrong type for socket Protocol not available Protocol not supported Socket type not supported Operation not supported Protocol family not supported Address family not supported by protocol Address already in use Cannot assign requested address Network is down Network is unreachable Network dropped connection on reset Software caused connection abort Connection reset by peer No buffer space available Transport endpoint is already connected Transport endpoint is not connected Cannot send after transport endpoint shutdown Too many references: cannot splice Connection timed out Connection refused Host is down No route to host Operation already in progress Operation now in progress Stale NFS file handle Structure needs cleaning Not a XENIX named type file No XENIX semaphores available Is a named type file Remote I/O error Disk quota exceeded No medium found Wrong medium type /dev/vc /dev/tts /dev/pts /dev /dev/tty POSIXLY_CORRECT %s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??? ??? 0 ???? +0-#'I npxXoudifFeEgGaACScs hlLjztqZ csync busybox 'mknod busybox busybox echo busybox dmesg busybox tinylogin busybox busybox kill busybox chmod busybox busybox busybox busybox umount busybox rmdir busybox busybox Ochown busybox "zcat busybox mkdir busybox busybox /ebusybox bFLT D"o ELFh :(0K @ #! bB? 0B2 0 @ c! @ #! Qgfff gfff @ c! internal error Rrwxst unknown mode: %s [%dD [%dA [%dC PATH `"#$%^&*()=+{}[]:;'|\<> %-14s exit EOF on %s %s %s differ: char %d, line %d adfipRr unable to stat `%s' Help ntok is null for starting position! What do I do? invalid byte or field list missing list of positions b:c:d:f:ns only one type of list may be specified the delimiter must be a single character you must specify a list of bytes, characters, or fields suppressing non-delimited lines makes sense only when operating on fields a delimiter may be specified only when operating on fields %2d%2d%2d%2d%d %d:%d:%d %d:%d %d.%d-%d:%d:%d %d.%d-%d:%d %d.%d.%d-%d:%d:%d %d.%d.%d-%d:%d Rs:ud: TZ=UTC0 cannot set date %a, %_d %b %Y %H:%M:%S GMT %a, %_d %b %Y %H:%M:%S %z %a %b %e %H:%M:%S %Z %Y %Y.%m.%d-%H:%M:%S count= seek= skip= conv= notrunc sync noerror invalid conversion `%s' standard input standard output %ld+%ld records in %ld+%ld records out /dev/root %-20s %9ld %9ld %9ld %3ld%% %s 1k-blocks %-20s %-14s %s %s %s %s Filesystem Used Available Use% Mounted on %s: can't find mount point. cn:s: klogctl %ld %s slxk +iu: %6s%13s%13s%13s%13s%13s total used free shared buffers %6s%13ld%13ld%13ld%13ld%13ld Mem: %6s%13ld%13ld%13ld Swap: Total: zcat ctfhdqv -q option not supported, ignored %s: Couldn't stat file %s compressed data not read from terminal. Use -f to force it. /dev/null .tgz Invalid extension Couldnt remove %s standard input ==> %s <== you must be root to change the hostname sethostname dfisF: ugrn uid=%ld(%s) gid=%ld(%s) isym != ((void *)0) insmod.c arch_apply_relocation got != 0 Warning: unhandled reloc %d .got myrelsec arch_create_got .plt %s multiply defined local symbol %s with index %ld exceeds local_symtab_size %ld .init .modinfo symbol for parameter %s not found improperly terminated string argument for %s parm_ invalid parameter %s parameter type 'c' for %s must be followed by the maximum size string too long for %s (max %ld) unknown parameter type '%c' for %s too many values for %s (max %d) invalid argument syntax for %s too few values for %s (min %d) QM_MODULES query_module: QM_INFO: %s query_module: QM_SYMBOLS: %s kernel: QM_SYMBOLS Using_Versions .this __this_module .kmodtab __ksymtab corrupt module %s? init_module cleanup_module __ex_table .text.init .data.init __archdata __kallsyms init_module: %s .kstrtab unresolved symbol %s .bss Relocation overflow Dangerous relocation Unhandled relocation %s of type %ld for %s %s of type %ld error reading ELF header not an ELF file ELF file not for this architecture ELF file not a relocatable object section header size mismatch: %lu != %lu error reading ELF section headers error reading ELF section data RELA relocations not supported on this architecture can't handle sections of type %ld symbol size mismatch: %lu != %lu relocation entry size mismatch: %lu != %lu kernel_version fkvxLo: %s/%s /lib/modules %s: no module by that name found Using %s Could not load the module Not configured to support old kernels A module named %s already exists Can't allocate kernel memory for module; needed %lu bytes create_module: %s killall %2d) %-16s bad signal name: %s Bad PID Could not kill pid '%d' %s: no process killed ###" %7ld %4ld %-10s %-8.8s %-8.8s %-8d %-8d %4d, %3d %9ld %24.24s %6.6s %5.5s %4.4s [%d;%dm -> 1AaCdgilnsxT:w:FpRrSvXcetuLk QM_MODULES Module Size Used by module %s: QM_INFO module %s: QM_REFS %-20s%8lu%4ld (deleted) (initializing) (uninitialized) (autoclean) (unused) %s%s invalid mode `%s' /lib/modules/ /modules.dep insmod -k %s 2>/dev/null acdklnqrst:vVC: -t and -C not supported rmmod %s %s %s No module or pattern provided insmod %s %s %s bind sync suid remount nosuid noexec nodiratime nodev noatime exec diratime defaults atime async Could not find a spare loop device Could not setup loop device WARNING: loop device is read-only afraxus: flggs: %#x, string_flags %s %s is write-protected, mounting read-only permission denied. Are you root? loop auto /proc/filesystems Mounting %s on %s failed /dev/root %s on %s type %s (%s) o:rt:wafnv /etc/fstab Cannot read /etc/fstab noauto swap Can't find %s in /etc/fstab SHELL HOME PATH BusyBox v0.60.3 (2004.09.06-05:39+0000) Built-in shell (msh) Enter 'help' for a list of built-in commands. .profile /etc/profile : cannot open out of string space is read-only export readonly until elif else then done while esac case syntax error 0123456789 `$ '" ;&<>()|^ word too long "'`$ no closing command line too complicated Terminated Alarm clock Bad system call Memory fault Bus error Killed Floating exception EMT trap Abort Trace/BPT trap Illegal instruction Quit Hangup Signal 0 /dev/null : cannot redirect shell command open create : illegal >& argument here file : cannot Signal - core dumped /proc/self/exe busybox /bin/sh no Shell program too big argument list too long not found cannot execute : no home directory : bad directory nothing to shift : not found Usage: read name ... trap: bad signal number : bad number bad break/continue level : bad identifier times newgrp login umask readonly export exit continue break trap eval read wait exec shift $`'" unclosed ${ string in ${} too long =-+? cannot use ${...=...} with $n missing value for unset variable: no closing ` try again grave: execlp failed input line too long Shell input nested too deeply too many files open in shell can't create pipe - try again here document ` ' unclosed /tmp/shtm unable to stat `%s' cannot overwrite directory with non-directory cannot overwrite non-directory with directory cannot remove `%s' mv: overwrite `%s'? unable to rename `%s' ne:f: %s%ld Name: %15c State State: %c Pid: Pid: %d PPid: %d Internal error! Uid: Uid: %d VmSize: VmSize: %d /proc Can't open /proc PID Uid VmSize Stat Command /proc/%s/status /proc/%s/cmdline %5d %-8s %c %5d %-8s %6d %c [%s] fiRr cannot remove `.' or `..' rmmod sleep exclude cxtzvOf:X:pC: Only one 'f' option allowed cd: %s: %s Error opening '%s' Exactly one of 'c', 'x' or 't' must be specified Unexpected EOF in archive %s: Cannot create hard link to '%s' %s: Cannot create symlink to '%s' %s: Cannot mknod %s: Cannot mkfifo Removing leading '/' from member names Bad tar header, skipping /%-d /%-s %ld,%-ld %lu %04d-%02d-%02d %02d:%02d:%02d link to %s -> %s Unknown file type '%c' in tar file Error reading tar file Error exit delayed from previous errors %0*lo ustar root %s: Unknown file type %s: socket ignored %s: file is the archive; skipping %s: Cannot open: %s Cowardly refusing to create an empty archive missing ] unknown operand %s: %s argument expected closing paren expected %s: out of range %s: bad number real %E user %u sys %T real %e user %U sys %S Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %x write error Command stopped by signal %d Command terminated by signal %d Command exited with non-zero status %d %ldh %ldm %02lds %ldm %ld.%02lds %lu%% %ld.%02ld cannot fork cannot run %s error waiting for child process Cannot open %s /dev/root /dev/loop forced umount of %s failed! %s busy - remounted read-only Cannot remount %s read-only proc Couldn't umount %s on %s: %s cannot get system name unknown %s%c %2d:%02d%s up %d day%s, %2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld PATH /bin:/sbin:/usr/bin:/usr/sbin:/usr/local/bin applet not found Usage: busybox [function] [arguments]... or: [function] [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use, and BusyBox will act like whatever it was invoked as. Currently defined functions: %s%s COMMAND's resource usage information is displayed Options: -v Displays verbose resource usage information. FILE [SUFFIX] [FILE]... [-R] MODE[,MODE]... FILE... [ -Rh ]... OWNER[<.|:>[GROUP]] FILE... FILE1 [FILE2] [OPTION]... SOURCE DEST [OPTION]... [FILE]... [OPTION]... [+FORMAT] [if=FILE] [of=FILE] [bs=N] [count=N] [skip=N] [seek=N] [conv=notrunc|noerror|sync] [-k] [FILESYSTEM ...] [FILENAME ...] [-c] [-n LEVEL] [-s SIZE] [-lsxk] [FILE]... [-neE] [ARG ...] [-iu] [-] [name=value]... [command] [OPTION]... FILE [OPTION] [FILE]... [OPTION] {hostname | -F FILE} [OPTIONS]... [USERNAME] [OPTION]... MODULE [symbol=value]... [-signal] process-id [process-id ...] [-signal] process-name [process-name ...] [OPTION] TARGET... LINK_NAME|DIRECTORY [-1AacCdeFilnpLRrSsTtuvwxXk] [filenames...] [OPTION] DIRECTORY... [OPTIONS] NAME TYPE MAJOR MINOR [FILE ...] [flags] DEVICE NODE [-o options,more-options] SOURCE DEST or: mv SOURCE... DIRECTORY process-name [process-name ...] [OPTION]... FILE... [OPTION]... [MODULE]... -[cxtvO] [--exclude FILE] [-X FILE][-f TARFILE] [-C DIR] [FILE(s)] ... EXPRESSION or [ EXPRESSION ] [OPTION]... COMMAND [ARGS...] [-c] FILE [FILE ...] [flags] FILESYSTEM|DIRECTORY [OPTION]... [COMMAND ...] [OPTION]... [STRING]... FILE zcat which uptime uname umount true touch time test sync sleep rmmod reset pidof mount modprobe mknod mkdir lsmod killall kill insmod hostname head halt gunzip free false echo dmesg dirname date clear chown chmod busybox basename Usage: %s %s No help available. --help BusyBox v0.60.3 (2004.09.06-05:39+0000) multi-call binary memory exhausted invalid date `%s' %s: input/output error -- %s too few arguments Names longer than %d chars not supported. %s%s%s unable to stat `%s' `%s' and `%s' are the same file %s: omitting directory `%s' is not a directory cannot create directory `%s' unable to open directory `%s' unable to close directory `%s' unable to change permissions of `%s' %s: overwrite `%s'? unable to open `%s' unable to remove `%s' unable to close `%s' unable to create `%s' cannot create fifo `%s' cannot create symlink `%s' unable to preserve ownership of `%s' internal error: unrecognized file type unable to preserve times of `%s' unable to preserve permissions of `%s' read Unable to read all data write Unable to write all data /proc Cannot open /proc /proc/%s/status %*s %s could not stat '/' /dev could not open '/dev' /dev/root ioctl: LOOP_CLR_FD ioctl: LOOP_SET_FD ioctl: LOOP_SET_STATUS /dev/loop%d rwxrwxrwx --------- ..s..s..t ..S..S..T 0pcCd?bB-?l?s??? /proc/mounts unknown group name: %s %-8ld unknown user name: %s unknown user name: %s unknown gid %ld %-8ld ugoa rwxst invalid number `%s' %s: Is directory abfnrtv\ gzip aborted Couldnt write Incomplete literal tree incomplete distance tree Invalid gzip magic unknown method %d -- get newer version of gzip it failed invalid compressed data--format violated internal error, invalid method invalid compressed data--crc error invalid compressed data--length error *** Couldnt kill old gunzip process *** aborting Couldnt wait ? %s: %s%s xstrndup bug getcwd() %s:%s unable to stat `%s' cannot remove `%s' %s: is a directory %s: descend into directory `%s'? unable to open `%s' unable to close `%s' %s: remove directory `%s'? unable to remove `%s' %s: remove `%s'? read write Cannot create directory `%s' Cannot set permissions of directory `%s' UNUSED WINCH PROF VTALRM XFSZ XCPU POLL STKFLT TRAP TTOU TTIN TSTP STOP CONT CHLD USR2 USR1 TERM ALRM PIPE SEGV KILL ABRT QUIT EXIT /etc/passwd /etc/passwd /etc/group /etc/group %s: %d: %s: Assertion `%s' failed. ?function? %s %s %s %s %d %d syslog <%d>%.15s [%d] [truncated] /dev/console /dev/log ""##$$$%%&& ???? %m/%d/%y %Y-%m-%d %H:%M %H:%M:%S ()*+ ,M4.1.0,M10.5.0 /etc/TZ $VVZ $(,048NULR e4^4 MfpY^Sb OP}7 ]evkk KL)~ KL)~ KL)~ znaaannN BqqYYii N[RTRRT iuzuiY <2***, g<-y Xx,3 FQ,p Zl" vLrR PX~Q ag0,- v &XZ b=&G u+r S35q{ sTEY5 PPtb !@Z"{ *gasNC DwHy ! PN P'+J hWd,jA *&HX] R)Q5M %ujY 6Bob >.?ZA! z%h? rER? '4md _$Us ,fI7@(@g $WZD /YA' z$~Q u*$~V El +!/_ ATtZ |gjM* q8;Z e`w| '2{Q m-/LK qQz* @ 8b mimDB l?P< U*H" cEl2 h4R=} 6wTD F@U va?7 tvCz %re4vWF a:8- lDimU _YCJ l"/\2 o}#c(5| FW:q {Rd| 3k6 _VWW %l$H m?>w PO?]) m6;ol mG4= .i3- N\E'f #t#| }F8c bwZ ls0/ |y'{kk jnN/ oeoU fnd[ nflo &ewkf\ XQkBz 1o G >_DGGr 2*?xZ $2xz, H%;:Xz ktTrFVBN 1/"3 OMMOa NII9 LK; Vc!d xiZ~ o~: +-(*9 /]RZ H4'u aZ/* "pkX tH*y<\uRR C^M! UR5'% kKjKJKK/ y~nH MZ5! 8}:5 {T;9 Y!_v k<& JTHh X[+5 o0i4 `$7@ lV = T4pB ]~.b ISTTT uYqq - m( oj*#~C' n*++ TY&/ i|ew cSRx` ;*qd [H"m t|~$ n~<` C.q~ 2kU. slbrJ gUc0 o|S!y0 (.z0 x3:6 wR:& r+?p p9=:& %('r!- &a0` tM3N hb` E69(i wqh9 v`|! a|w"? Hpw? vn`B 12"\ ScN_W $N)? ^#=l KpLB|$ Npx< =xHn2 nziy a;m# ygk+ t7)A tv1x cAi? !3*n ]GW+ ErF0" SXJ\%.B9Ps+ Za*j G+>pE v\om' _/TX .tuy WK= XW'o /'%c& ZZjX .b_;: Juqh_ ++Rk VWTV |-mpy >pQY ZS1# y@qi '2TkJ L3j5AG ^h}C iqkm ij$^B | wC YE0J g5B# 6Xh1 ZFQ$ *]RR U,i5 \/WW 76]! >Fpw 9V=t j7>v Un:$ Hv6F_6 nOm * +{+x 1G|@ V:#Zi; \;i[ h0O0so gf"G -Vz? le5] %}lU p*(~~ ~J{- F_5~| l~mR KMJJ ()iAR O_I0 iA#} Md$[z >l/Lx R1Sylbb| )Slb|b RKjl: I)|1* kjkjj dU%; CYh] t~+W9, .3&; \a+, ^,)--+[ XVVVZ />]XP 6:442 zwm~Y KAyR xuhd O7%i <*W x~Di| aLob EIZI' _Uqu IQ0= q2V1I k0>H /oaQ PW64q L fDnDDrN PSAi 07#U iKLU +n&~ Sfwi dUP" @v," ?(?a 'N2?q 'N2?q 'N2?q 'N2?q 'N2?q 'N2?q 'N2?q |6>L 97+s^ =*xqk T0=Z I`QVP 'R2?q 'N2?q >KJN _vZR< IN=p _#=]x 7D[y J||| iQ1bX NTU] )Num hu`vgN pd%#vI xt8i 0?d} l6KGgG[[ uTQ"?Bb W7n@Z /?m(]W i~1rRK _ue{/ Z;h~[ '?}) o`0+i H1,y lYtt _rBX y0itdd zGnb~} \0hA *k_? niim qptdll RYi< +.**, Mrxl| _[@I EoMW ==6q F$}} ywCx; L**/VUU ST|~ {32= LMMU* RqO@ D] My S0;>N Np,n hOG> )HWW 4+8_e~}%3 S|G` /bUd adQ9 rIF& x'{n7B `9%# ~")@ v17v $` g _tjG< kfSe\ P 73,M kjjjk fh4([ fs=p W[ghll ~s:F vmbb nM&B\ FZPU KY\~WI O,~* l6wtw uutv s}}} 2{zhXXXhXh( _xxh Eay| 7rln <~uJ0 8;/] /"*** zu[G w)ehy 70pe+ ]fFZ [XRZ^a iA[@ RT`*/+.., d=&eu \TTUUe UQQ^ oj=w QXXXT\Z IIiYyy9> 1F0! \[y. //eh dvdd6a W)Pz hV}H >?vz0C scRpm WsC$ &dz~4 LN6um O"?~ O"?~ p8?]V G7l~t -Soh y~,g O"?~ 8|?}+9 BZ/? CQz$c ?:#Z bDg7/ O"?~ 9F/v O"?~ G=mV2 S"?} O"?~ $VvX xd+{ |&2K v`@+ DTW5 "zc}e O"?~ 899M 8O///ggg !'\ 4ueq iS'? /%E._ *"S^ >z89~ ?,*-3Y,N $4$l' >E\rl ?f~)i _%Ob R$B~ MLML ohbb H~].7 9|fg No G lw_ Z YKGdP ]0.~ $'A~ `VY| / ~w =<68 "~Ja >cYz&L ?80886 xwtb utE"~ xorD }%v+ `[ho %I{9 /v)W ^'~m -#E3 L%k? S$1/mv 0).-Fu0> 0>Q:c X,1YV1 6YR# "=:" bJ~4v~ &*!L `J~4~~ ?==%&J $".. E&I:x &<$, 42 > #,,lGx ].4=e tuYgRe 7?j5 ]fn~ 8M&+ Kv^K |blja ;__k mAaI PnaqA )sj% (Tgg ~$Y] ~uFC 8%`7,(?[3 H-En /fLg 9~iO o8qa w8VVg:N //KO d=Q_ yy,?C fVWWg\g ,?n| |MN9 ]kPSW ZGig /**x{_ v\wM &xy0 M0Vx Or^gE/ 0|`V Bvvvx W3^z)++s Y,.+3 vuJrJ _p|n ra^0/ l4mPF MjY%! (e54} B.'i MJy% }tb} kB#h `Vz^ =A|us n tYukx mQ.bx Se@ _\D+ _\D+Can't find ASF_File_Properties_Object GUID Error: Can't lseek Error: Can't read WAVEFORMATEX size Can't find ASF_Audio_Media GUID Error: Can't read BITMAPINFOHEADER size Error: not read Can't read. offset(%d) Error: not open %s Error: not read file header Error: Can't read asf video data Error: Can't read asf audio data Error: Can't read asf max bit rate %.4s MULAW G726 MPEGLAYER2 WMA V2 ITI G726 NO AUDIO UNKNOWN AskPopup_SEL_process AskPopup_SELL_process AskPopup_RIGHT_process AskPopup_LEFT_process AskPopup_PLAY_process AskPopup_PLAYL_process AskPopup_Mch_comrun_process Error: Can't lseek Error: Can't read 4 byte Error: not find avih Error: Can't read MainAVIHeader size Error: Can't read hdrl size Error: Can't read avih size Error: Can't read strl Error: Can't read fccType Error: Not find strf : %.4s Error: Can't find %.4s Error: Can't read AVIStreamHeader size Error: Can't read BITMAPINFO size Error: Can't read WAVEFORMATEX size Error: not open %s Error: not read file fcc Error: not open %s Error: Can't get file state Error: Can't read avi header data Error: Can't read avi video data Error: Can't read avi audio data %.4s MULAW G726 MPEGLAYER2 WMA V2 ITI G726 NO AUDIO UNKNOWN -[ avih ]---- dwMicroSecPerFrame (%u) dwMaxBytesPerSec (%u) dwReserved1 (%u) dwFlags (%u) dwTotalFrames (%u) dwInitialFrames (%u) dwStreams (%u) dwSuggestedBufferSize (%u) dwWidth (%u) dwHeight (%u) -[ strh ]---- fccType (%.4s) fccHandler (%.4s) dwFlags (%u) dwPriority (%u) dwInitialFrames (%u) dwScale (%u) dwRate (%u) dwStart (%u) dwLength (%u) dwSuggestedBufferSize (%u) dwQuality (%u) dwSampleSize (%u) rcFrame_a (%u) rcFrame_b (%u) -[ BITMAPINFO ]---- biSize (%u) biWidth (%u) biHeight (%u) biPlanes (%u) biBitCount (%u) biCompression %-12.4s biSizeImage (%u) biXpelsPerMeter (%u) biYpelsPerMeter (%u) biClrUsed (%u) biClrImportant (%u) ------------------- -[ WAVEFORMATEX ]---- wFormatTag %12u (%08x) nChannels %12u (%08x) nSamplesPerSec %12u (%08x) nAvgBytesPerSec %12u (%08x) nBlockAlign %12u (%08x) wBitsPerSample %12u (%08x) cbSize %12u (%08x) -[ AV FORMAT ]----- video codec %s width, height %u x %u video bit rate %u Kbps video frame rate %u Fps audio codec %s audio sample rate %u Hz audio bit rate %u Kbps %.4s MULAW G726 MPEGLAYER2 WMA V2 ITI G726 NO AUDIO UNKNOWN Error: Can't get avi format Error: Can't get asf format snprintf: overflowed array <%2d>: %s [%#x] menuNum: %d , comCurPos : %d /mnt/Root/ curPos=>%d %s%s strListName=>%s listNum=>%d MarkMode=>%s TRUE FALSE curPath=>%s WSZ:%d, WSP:%d, WEP:%d, WCP:%d, CP:%d curPos=>%d, %s %s [%d][%d][%3d]<%s> %s , %#x strListName=> %s titleIconType=> %d curPos=>%d, %s Stack Overflow Stack underflow Invalid range %s open fail error : %s %s check identify fail read identify fail read playlistname fail /mnt/Root/iRiverSys/etc/tmpVideoNaviResume.irv /mnt/Root/iRiverSys/etc/tmpAudioNaviResume.irv %s error : %s %s open fail errno : %d read curpath fail /mnt/Device/ iRiverSys Recycled System Volume Information %s/%s Album Artist Genre /mnt/ramdisk/root/ %s%s/ Current free mem : %d file open error : %s /mnt/Root/ pTotal : %d, pFree : %d, s.f_blocks %d, s.f_bsize %d vfat Source is already mount Not block device No menory path is not searchable mount error It's not a mount point Device is busy umount error /dev/hda1 /mnt/Root/iRiverSys/etc/tmpFileRightNaviBack.irv /mnt/Device/ %s%d Fail to mount [%d] %b%d /mnt/Root/record/ %s%03d.%s %b%d%H%M%S %s.%s #EXTM3U #EXTINF: res = %d #EXTM3U #EXTINF %s%s move_file fail There is IDB file problem No file to del list [Warning] Turn the power off and on again to apply the language setting PMP-100 can't perform it while playback. [COPY] Are you sure ? Preparing for copy Wait a second, please. %s (%d) CopyPreWaitingAskPopupFunc already is exists! Overwrite ? Yes all ) / 8( Copy is completed. 6(success) / 8(total) )/%d( %d(succes)/%d(total) [MOVE] [Moving] Moving file(s).... Move is completed. [DELETE] Deleting file(s)... )/8( Delete is completed. 6(success)/8(total) [LOAD LIST] Unknown is loading. is loaded. Loading playlist failed ! [CREATE LIST] The new list is created. [SAVE LIST] Saving... is saved. [DB [DB Scan] Scaning DB...... DB Scan is completed. DB Scan failed. )/%d( %d(current)/%d(total) INCOMPATIBLE FORMAT PMP-100 can't play this file [F/W [F/W Upgrade] The battery is low on charge [Sleep Timer] PMP-100's going down for the sleep timer [Stop Power Off] for the stop power off %s:%s ==== gcomrunStatus ==== runFlag : %d totalNum : %d curCnt : %d successCnt : %d fileSize : %d runSize : %d fileName : %s can not get source_stat unable to stat `%s' `%s' and `%s' are the same file `%s' is not a directory cannot create directory `%s' unable to open directory `%s' unable to close directory `%s' unable to change permissions of `%s' cancel copy `%s' unable to remove dest file `%s' unable to open dest file `%s' unable to open source file `%s' stop copy or copy_file_chunk error `%s' unable to close dest `%s' unable to close `%s' unlink [%s] unable to remove `%s' internal error: unrecognized file type there is no src file %s mv : overwrite %s ? path not exist unable to stat `%s' unable to open `%s' unable to unlink `%s' %s%s%s print free mem : %d old_copyRate : %d, new_copyRate : %d Cannot create directory `%s' Cannot set permissions of directory `%s' unable to remove [%s] ComPopup_SEL_process gpCurBrowser->listNum : %d Add List New List Save List Play ComPopup_SELL_process ComPopup_RIGHT_process ComPopup_LEFT_process ComPopup_UP_process File_UPL_process File_UPS_process ComPopup_DOWN_process ComPopup_DOWNL_process ComPopup_DOWNS_process ComPopup_NAVI_process ComPopup_PLAY_process ComPopup_Mch_file_process /mnt/Device/ /mnt/Root/ ComPopup_Mch_navi_process ComPopup_Mch_filePls_process ComPopup_Mch_audio_process /mnt/Root/iRiverSys/etc/tmpAudioNaviBack.irv ComPopup_Mch_video_process /mnt/Root/iRiverSys/etc/tmpVideoNaviBack.irv ComPopup_Mch_photo_process /mnt/Root/iRiverSys/etc/tmpPhotoNaviBack.irv ComRun_PLAYL_process ChangeComRunFlag(COM_FALSE) ComRun_Mch_filePls_process ComRun_Mch_navi_process ComRun_Mch_file_process /mnt/Device/ /mnt/Root/ ComRun_Mch_audio_process /mnt/Root/iRiverSys/etc/tmpAudioNaviBack.irv ComRun_Mch_video_process /mnt/Root/iRiverSys/etc/tmpVideoNaviBack.irv ComRun_Mch_photo_process /mnt/Root/iRiverSys/etc/tmpPhotoNaviBack.irv ComRun_Mch_setup_process ComRun_Mch_info_process /mnt/Root/iRivNavi.iDB Artist Album Genre List : %#x, Head : %#x DLISTSEG %#x , pData %#x, , pNext %#x, pData2 %#lx List : %#x, Tail : %#x %s%s /mnt/Root/ 1st check string : [%s] 2nd check string : [%s] Designed by iRiver ========================================== path : %s title : %s artist : %s album : %s genre : %s DlistStrPrint(DLISTSEG * %#lx) pData(DLIST) : %#lx , pData2(str): %s cnt : %d Emergency_SEL_process ======== ======== eqMode : %d %d[%d] ***** Exif Information v0.2 ***** Image Size : %d x %d X resolution : %d Y resolution : %d Make : %s Model : %s Software : %s Datetime : %s Exposure time : %d Exposure time : 1/%d F-number : %f ISO speed ratings : %d Shutter Speed value : %f Aperture value : %f Flash mode : %d Focal length : %f Exposure mode : %d White balance : %d Exif Information not exist... Exif IFD Pointer not exist... Next IFD Pointer not exist... Thumbnail Offset = %x Thumbnail Size = %x File_SEL_process File_SELL_process File_RIGHT_process File_EQ_process File_LEFT_process File_LEFTL_process File_UP_process File_UPL_process File_UPS_process File_DOWN_process File_DOWNL_process File_DOWNS_process FILE_AB_process FILE_ABL_process File_NAVI_process File_NAVIL_process File_EQL_process File_PLAY_process do not play at usb device popup No file in playlist File_PLAYL_process File_Mch_audio_process /mnt/Root/iRiverSys/etc/tmpAudioNaviBack.irv File_Mch_video_process /mnt/Root/iRiverSys/etc/tmpVideoNaviBack.irv File_Mch_photo_process /mnt/Root/iRiverSys/etc/tmpPhotoNaviBack.irv load setup tuner info 1st is %x load setup tuner Band is %x Korea Japan Europe HongKong China fm region error Tuner Mode : %d Tuner Band : %d Tuner is_stereo : %d Tuner wantFreq : %d Tuner chPos : %d Tuner number of memory : %d Tuner saved channel : %d (%d) save setup tuner info 1st is %x TunerData->wantFreq is %x save index: %d, data: %d FilePls_SELL_process FilePls_LEFTL_process FilePls_UP_process FilePls_UPL_process FilePls_UPS_process FilePls_DOWN_process FilePls_DOWNL_process FilePls_DOWNS_process FilePls_AB_process FilePls_NAVI_process FilePls_NAVIL_process FilePls_EQ_process FilePls_EQL_process FilePls_PLAY_process No file in playlist FilePls_PLAYL_process FilePls_Mch_audio_process FilePls_Mch_video_process FilePls_Mch_photo_process FilePls_Mch_photozoom_process FilePls_Mch_photofocus_process FM STORED DATA IS INVALID...SWITCH TO DEFAULT res is %d default_mode is %d Tuner Mode : %d Tuner Band : %d Tuner is_stereo : %d Tuner minFreq : %d Tuner maxFreq : %d Tuner wantFreq : %d Tuner chPos : %d Tuner number of memory : %d Tuner saved channel : %d (%d) i2cData[%d] : %x FM Load default.... i2c success.. i2c failed.. ==== gTuner.numChannel : %d auto search flag set!!! Unknown SynthPop JPop Anime Thrash Metal Salsa Merengue Christian Rock Contemporary C Crossover Black Metal Heavy Metal Christian Gangsta Beat Polsk Punk NegerPunk BritPop Indie Terror Hardcore Club House Drum & Bass Dance Hall Euro-House A Capella Drum Solo Punk Rock Duet Freestyle Rhythmic Soul Powder Ballad Ballad Folklore Samba Tango Club Slow Jam Satire Porn Groove Primus Booty Bass Symphony Sonata Chamber Music Opera Chanson Speech Humour Acoustic Easy Listening Chorus Big Band Slow Rock Symphonic Rock Psychedelic Rock Progressive Rock Gothic Rock Avantgarde Bluegrass Celtic Revival Latin Bebob Fast-fusion Swing National folk Folk/Rock Folk Hard Rock Rock & Roll Musical Retro Polka Acid Jazz Acid Punk Tribal Lo-Fi Trailer Showtunes Rave Psychadelic New Wave Cabaret Native American Jungle Pop/Funk Christian Rap Top 40 Gangsta Cult Comedy Southern Rock Dream Eurodance Pop-Folk Electronic Techno-Industrial Darkwave Gothic Ethnic Instrumental Rock Instrumental Pop Meditative Space Punk Soul Bass AlternRock Noise Gospel Sound Clip Game House Acid Instrumental Classical Trance Fusion Jazz+Funk Vocal Trip-Hop Ambient Euro-Techno Soundtrack Pranks Death Metal Alternative Industrial Techno Rock Reggae Other Oldies New Age Metal Jazz Hip-Hop Grunge Funk Disco Dance Country Classic Rock Blues pLyricData : %#lx ========================================== decodeValue : %d [%x] lineNum : %d syncTime[%d] : %ld [%lx] size[%d] : %d [%x] strLyrics[%d] : [%2x] --------------------- USLT title : %s artist : %s album : %s genre : %s No USLT tag infomation over the line num %d : lineNum : %d Noontang version error Noontang syncStart value error FrameId : %s Size : %ld Flags : %s info : %s TIT2 TPE1 TALB TCON is not valid mp3 id3v2 tag can not fine tag frame infomation file Size too small id3v2 offset fseek error yyxxxxxy ???~~||||~?? playing the file Pos=%d,listNum=%d,%s... playing the file %s... 800 : out_buf_width = %d, out_buf_height = %d Height_limit =%d Width_limit = %d ImgRotate : angle = %d ImageType : %d Image Size : %d x %d Bytes : %ld ------------------------- Maker : %s Model : %s Software : %s Datetime : %s Exposure time : %ld s Exposure time : 1/%ld s F-number : %d.%d ISO speed ratings : %d Shutter Speed value : %f Aperture value : %d.%d Flash used : Flash fired Flash did not fired Focal length : %d.%d mm Exposure mode : %d White balance : %d Info_EQ_process FilePls_Mch_photo_process FilePls_Mch_photofocus_process FilePls_Mch_photozoom_process FilePls_Mch_video_process FilePls_Mch_navi_process FilePls_Mch_filepls_process FilePls_Mch_file_process Load_SEL_process Menu_SEL_process Menu_SELL_process Menu_RIGHT_process Menu_RIGHTS_process Menu_LEFT_process Menu_LEFTS_process Menu_PLAY_process remocon power off /dev/powerkeymod powerkeymod open error Menu_Mch_audio_process /mnt/Root/iRiverSys/etc/tmpAudioNaviBack.irv Menu_Mch_video_process /mnt/Root/iRiverSys/etc/tmpVideoNaviBack.irv Menu_Mch_photo_process /mnt/Root/iRiverSys/etc/tmpPhotoNaviBack.irv Menu_Mch_file_process /mnt/Root/iRiverSys/etc/tmpFileLeftNaviBack.irv /mnt/Root/iRiverSys/etc/tmpFileRightNaviBack.irv /mnt/Device/ Menu_Mch_setup_process Menu_Mch_tuner_process Korea Japan Europe HongKong China fm region error gRegionCode is %d gTuner.Band is %d tmpBand is %d Tuner Region has changed... Menu_Mch_record_process NoRecordFile Menu_Mch_filePls_process Menu_Mch_navi_process JFIF $Exif Adobe Photoshop 7.0 2004:03:11 17:57:05 JFIF Adobe_CM Adobe b34r 7GWgw AQaq" dEU6te '7GWgw JpP2 K,sC [^F5 {K2hkX 3]f ;45R ,3m] Zwcc;N, Wd3uo ='u'd 7f?- j(`o 3K}__f VFF3Kj IONz h}#? ~&;)k 0r1?d Photoshop 3.0 8BIM 8BIM 8BIM 8BIM x8BIM 8BIM 8BIM 8BIM' 8BIM 8BIM 8BIM 8BIM 8BIM 8BIM 8BIM null boundsObjc Rct1 Top long Leftlong Btomlong Rghtlong slicesVlLs Objc slice sliceIDlong groupIDlong originenum ESliceOrigin autoGenerated Typeenum ESliceType Img boundsObjc Rct1 Top long Leftlong Btomlong Rghtlong urlTEXT nullTEXT MsgeTEXT altTagTEXT cellTextIsHTMLbool cellTextTEXT horzAlignenum ESliceHorzAlign default vertAlignenum ESliceVertAlign default bgColorTypeenum ESliceBGColorType None topOutsetlong leftOutsetlong bottomOutsetlong rightOutsetlong 8BIM 8BIM 8BIM JFIF Adobe_CM Adobe b34r 7GWgw AQaq" dEU6te '7GWgw JpP2 K,sC [^F5 {K2hkX 3]f ;45R ,3m] Zwcc;N, Wd3uo ='u'd 7f?- j(`o 3K}__f VFF3Kj IONz h}#? ~&;)k 0r1?d 8BIM 8BIM Hhttp://ns.adobe.com/xap/1.0/ adobe:docid:photoshop:58d1c1e4-7322-11d8-9d4c-cc9b250af278 Adobe DTsEF7Gc(UVW u*9:HIJXYZghijvwxyz T6Ed' UeuV7 (GWf8v HXhx 9IYiy *:JZjz #+rQ y08] ypxn uQlj hY$Mq ) ]R 5$Xzo L|UL >iM-DBY n K;V$ DDi/to^ YI$U msgq_id = %x : Error Number: %d :Error = %d : Errno = EINTR()%d MSG_Recv fileInfo : %x running Receive Thread rcv_control_id is %d ImgPlay : playing the file %s... CodecPaly but_status %x sys_play_decode playStartPos : %ld sys_play_open >>DISP_TV: basep_x(%d) basep_y(%d) shuffle randnum : %d, num : %d final playPos :%d PL_mode has changed to %d sys_status is %x sys_setup is %x ================================ Error while opening file "%s" Error while trying to determine file stats image size is too big image_buf addr is %x image display buffer addr is %x IMGResize: *** INPUT PARAMETERS *** ==> DisplaySize: %u x %u ==> DecodedSize: %u x %u ==> Window Width: %u IMGResize: Image display size 1: %d x %d IMGResize: Image display size 2 : %d x %d IMGResize: New image display size: %d x %d IMGResize: Image output size: %d x %d PainVID1 = %d prev_temp Addr =%x Rotate_temp Addr =%x ImageDisplay : out_buf_width = %d, out_buf_height = %d, (v_gab,h_gab) = (%d,%d),tv_height = %d ImgDisplay : init = %d ImgDisplay1 : init = %d Audio_SEL_process Audio_SELL_process Audio_RIGHTS_process Audio_LEFTS_process Audio_NAVI_process Audio_NAVIL_process Audio_PLAY_process %s%s playing the file %s... Audio_PLAYL_process Audio_STOPS_process Audio_Mch_filePls_process Navi_SEL_process Navi_SELL_process Navi_RIGHT_process Navi_RIGHTL_process Navi_LEFT_process Navi_LEFTL_process Navi_UP_process Navi_UPL_process Navi_UPS_process Navi_DOWN_process Navi_DOWNL_process Navi_DOWNS_process Navi_AB_process Navi_ABL_process Navi_NAVI_process Navi_NAVIL_process Navi_EQ_process Navi_EQL_process Navi_PLAY_process No file in playlist Navi_PLAYL_process Navi_Mch_audio_process FilePls_Mch_video_process Navi_Mch_photo_process Navi_Mch_photozoom_process Navi_Mch_photomulti_process Navi_Mch_photofocus_process Photo_SEL_process Photo_SELL_process Photo_RIGHT_process Photo_RIGHTL_process Photo_LEFT_process Photo_LEFTL_process Photo_UP_process Photo_UPL_process Photo_DOWN_process Photo_DOWNL_process Photo_AB_process Photo_ABL_process Photo_NAVI_process Photo_NAVIL_process Photo_EQ_process Photo_EQL_process Photo_PLAY_process Photo_PLAYL process Photo_Mch_filepls_process PhotoFocus_RIGHT_process PhotoFocus_RIGHTL_process PhotoFocus_LEFT_process PhotoFocus_LEFTL_process PhotoFocus_UP_process UP zoomfactor = %d PhotoFocus_UPL_process PhotoFocus_DOWN_process PhotoFocus_DOWNL_process PhotoFocus_AB_process PhotoFocus_NAVI_process PhotoFocus_NAVIL_process PhotoFocus_EQ_process PhotoFocus_EQL_process PhotoFocus_PLAY_process PhotoFocus_PLAYL process PhotoFocus_Mch_file_process PhotoFocus_Mch_photo_process PhotoFocus_Mch_photozoom_process PhotoMulti_RIGHT_process PhotoMulti_RIGHTL_process PhotoMulti_LEFT_process PhotoMulti_LEFTL_process PhotoMulti_ABL_process PhotoMulti_NAVI_process Audio_NAVIL_process Audio_EQ_process Audio_EQL_process PhotoMulti_PLAY_process PhotoMulti_PLAYL process PhotoMulti_Mch_file_process PhotoZoom_RIGHT_process PhotoZoom_RIGHTL_process PhotoZoom_RIGHTS_process PhotoZoom_LEFT_process PhotoZoom_LEFTL_process PhotoZoom_LEFTS_process PhotoZoom_UP_process UP zoomfactor = %d PhotoZoom_UPL_process PhotoZoom_UPS_process DOWN zoomfactor = %d PhotoZoom_DOWNL_process PhotoZoom_DOWNS_process PhotoZoom_AB_process : zoomfactor = %d PhotoZoom_ABL_process PhotoZoom_NAVI_process PhotoZoom_NAVIL_process PhotoZoom_EQ_process PhotoZoom_EQL_process PhotoZoom_PLAY_process PhotoZoom_PLAYL process PhotoZoom_Mch_file_process PhotoZoom_Mch_photo_process resizeDimension : xin=%d,yin=%d,xout=%d,yout=%d,prev->h_rsz=%d prev->hsize=%d, prev->v_rsz=%d,prev->vsize=%d bright level : %d s_time : %d NTSC video output format error /dev/hda stat dev file error open device file %s error HDD change to standby HDD change to sleep mode unmounting %s... /mnt/Root/ umount error HDD resetting.... HDD reset error mounting %s... mount error HDD change to idle HDIO_DRIVE_CMD(SETIDLE) failed volume_power On volume_power Off Record_SELL_process Record_NAVIL_process NoRecordFile /mnt/Root/iRiverSys/etc/tmpAudioNaviBack.irv /mnt/Root/record/ /mnt/Root/ Record_PLAYL_process Record_REC_process %s%s LINE-IN EXT-MIC INT-MIC 44.1Khz 32Khz 128Kbps 96Kbps audio input gain is %d Record_RECL_process Setup_SEL_process Setup_SELL_process Setup_RIGHT_process Setup_RIGHTS_process Setup_LEFT_process Setup_UP_process Setup_LEFTS_process Setup_DOWN_process Setup_DOWNS_process Setup_NAVI_process Setup_NAVIL_process Setup_PLAY_process Setup_PLAYL_process Setup_Mch_audio_process Setup_Mch_video_process Setup_Mch_photo_process Setup_Mch_photozoom_process Setup_Mch_photomulti_process Setup_Mch_photofocus_process Setup_Mch_file_process Setup_Mch_filepls_process Setup_Mch_menu_process Setup_Mch_tuner_process Korea Japan Europe HongKong China fm region error gTuner.Band is %d tmpBand is %d fm start..... Setup_Mch_record_process SetupDetail_SEL_process SetupDetail_SELL_process SetupDetail_RIGHT_process SetupDetail_RIGHTL_process SetupDetail_RIGHTS_process SetupDetail_LEFT_process SetupDetail_LEFTL_process SetupDetail_LEFTS_process SetupDetail_UP_process SetupDetail_UPL_process SetupDetail_DOWN_process SetupDetail_DOWNL_process SetupDetail_NAVIL_process SetupDetail_PLAY_process SetupDetail_PLAYL_process SetupDetail_Mch_audio_process SetupDetail_Mch_video_process SetupDetail_Mch_photo_process SetupDetail_Mch_photozoom_process SetupDetail_Mch_photomulti_process SetupDetail_Mch_photofocus_process SetupDetail_Mch_file_process SetupDetail_Mch_filepls_process SetupDetail_Mch_menu_process SetupDetail_Mch_tuner_process Korea Japan Europe HongKong China fm region error gRegionCode is %d gTuner.Band is %d tmpBand is %d fm start..... SetupDetail_Mch_record_process /dev/powerkeymod powerkeymod open error /mnt/Root/allimg.hex [%#x] [%x] ver[4] : [%#x] crcCheckSum : %#x +++++++++++++++ crcCheck Error Success crcCheck ver[5] : %#x /mnt/Root/ iRiverSys.tar Firmware Ok ERROR: Firmware fail General Language FM region Korea Japan Europe HongKong China Video Resume Load Default Display Video Output NTSC LCD LCD Brightness TV X Position TV Y Position Power Sleep Timer On/Off Sleep Time(Min) Stop Power Off Power Off(Min) LCD Off(Sec) Mode Play Mode Repeat None 1 Song All Songs Shuffle Intro Visual Lyric Level Meter Video Caption Caption H align Bottom V align Left Center Right Caption Delay Sound Normal Rock Jazz Classic UBass User Volume Balance User EQ 60Hz(db) 250Hz(db) 1KHz(db) 4KHz(db) 12KHz(db) Clock Hour Minute Month Year System USB USB Device Record Source LINE-IN INT-MIC Samplerate 32Khz 44.1Khz Bitrate 128Kbps 96Kbps Line In Volume video output format error Music mode setup value error Music shuffle setup value error Music intro setup value error %a %b %e %H:%M:%S %Z %Y can not adapt the time to kernel ++ Off from fm mode, saving data....+++++++++ pmp100.tar %2d.%02d Upgrade to %2d.%02d Korean fm region error poweroff_tick_func: gSleepSetTime+gSleepTime : %d, curTime : %d currentPath : %s fileName : %s current state is %d audioCodec : %d videoCodec : %d FileFormat : %d streamWidth : %d streamHeight : %d frameRate : %d videoKBitRate : %d audSampleRate : %d audBitsPerSec : %d fileSize : %d totalTime : %d Slacktime: Start=
  SUB: Adjusted %d subtitle(s). dumpsub.smi dump_jacosub: fopen

This site hosted by Free.ProHosting.com
Google

%s%s

  SUB: Subtitles dumped in 'dumpsub.smi'. sami SUB: Could not determine file format SUB: Detected subtitle file format: %s [smi] protect exit overflow memory SUB: Read %i subtitles , %i bad line(s). %i line%c (%li-%li) %d: %s%s wholetext : %s Subtitle format %s time. uses doesn't use Read %i subtitles, %i errors. pCaption->line_cnt : %d pCaption->caption_len[%d] : %#x pCaption->x_offset[%d] : %#x pCaption->y_offset[%d] : %#x [%#4x] Couldn't load file. 0123456789ABCDEFGHIJ0123456789ABCDEFGHIJ Audio_SELL_process Tuner LEFTS_process... No memory detected In the Memory mode. quit memory mode first! Audio_NAVIL_process Tuner AB process... Stereo indication success Stereo indication failed Tuner_play_process Tuner PLAYL precess.. Tuner_REC_process Tuner_RECL_process Tuner_Mch_menu_process auto search flag set... TunerAction_Mch_tuner_process /root/pmp00.dat /mnt/Root/iRiverSys/bmp/pmp11.dat /mnt/Root/iRiverSys/bmp/pmp12.dat /mnt/Root/iRiverSys/bmp/pmp01.dat /mnt/Root/iRiverSys/bmp/pmp02.dat /mnt/Root/iRiverSys/bmp/pmp03.dat /mnt/Root/iRiverSys/bmp/pmp04.dat /mnt/Root/iRiverSys/bmp/pmp05.dat /mnt/Root/iRiverSys/bmp/pmp07.dat /mnt/Root/iRiverSys/bmp/pmp06.dat /mnt/Root/iRiverSys/bmp/pmp08.dat /mnt/Root/iRiverSys/bmp/pmp09.dat /mnt/Root/iRiverSys/bmp/pmp10.dat Root Level Meter Lyric Error: Bad PMPUSB_T lcstr(%p) get_stpos ret (%d) 00. st_pos(%d), n(%d) 0. ucstr_l(%d) ret(%d) 1. ucstr_l(%d) ret(%d) 2. ucstr_l(%d) ret(%d) /dev/fb0 /dev/fb1 /dev/fb2 /dev/fb3 failed to open %s, errno=%d Failed to open %s, errno=%d Failed to close %s, errno=%d Failed to get fix info for video win0, errno=%d Failed to get fix info for video win1, errno=%d Failed to get fix info for OSD win0, errno=%d Failed to get fix info for OSD win1, errno=%d Failed to get var info for video win0, errno=%d Failed to get var info for video win1, errno=%d Failed to get var info for OSD win0, errno=%d Failed to get var info for OSD win1, errno=%d Failed to put var info for video win0, errno=%d Failed to put var info for video win1, errno=%d Failed to put var info for OSD win0, errno=%d Failed to put var info for OSD win1, errno=%d Failed to get position win0, errno=%d Failed to get position win1, errno=%d Failed to put position win0, errno=%d Failed to put position win1, errno=%d Failed to get rectangular cursor position, errno=%d Failed to put rectangular cursor position, errno=%d Failed to get rectangular cursor size, errno=%d Failed to put rectangular cursor size, errno=%d Failed to get video_mode, errno=%d Failed to put video_mode, errno=%d Failed to get video Win0 mode, errno=%d Failed to get video Win1 mode, errno=%d Failed to get OSD Win0 mode, errno=%d Failed to get OSD Win1 mode, errno=%d Failed to put video Win0 mode, errno=%d Failed to put video Win1 mode, errno=%d Failed to put OSD Win0 mode, errno=%d Failed to put OSD Win1 mode, errno=%d Failed to get rectcursor_mode, errno=%d Failed to put rectcursor_mode, errno=%d Failed to get mmap video win0, errno=%d Failed to get mmap video win1, errno=%d Failed to get mmap OSD win0, errno=%d Failed to get mmap OSD win1, errno=%d _____________DUMP FM_____________ mode(%s) numChannel(%d) chPos(%d) _________________________________ [%05d] ^ #####[UI] BAD REGION Failed to get OSD mode, errno=%d Failed to put OSD mode, errno=%d Failed to put var info for OSD win0, errno=%d Failed to put position win0, errno=%d Failed to put var info for OSD win1, errno=%d Failed to put position win1, errno=%d %s : major(%02x), minor(%02x), size(%ld) Error: file not open Error: file not read Error: Incorrect BMP_MAJOR VERSION Error: Incorrect BMP_MINOR VERSION Error: fstat failed Error: file size(%ld) not match Error: Bad BMP file Error: file open %s Error: Bmp ymalloc error Error: file read >> Error: bad scale number(%d). INFORMATION MORE > %10s Name : Type : Size : %d x %d Bytes : %d KB Maker Model Software Date/Time Exposure Time %d s 1/%d s F-number %5.1f ISO Speed Rate AUTO Shuter Time Flash Used Flash firedn Flash did not fired Focal Length %d mm Exposure Mode White Balance error : not supported attribute JPEG TIFF UNKNOWN Temporary Filename Source Elapsed Name 44.1Khz 32Khz 128Kbps 96Kbps -:--:-- %02d:%02d:%02d %02d:%02d NoRecordFile General Display Power Mode Sound Clock System Record PMP-100 Ver. %2d.%02d Hard Disk Total %d MB Free %d MB %02d INFORMATION Name : Format : Size : Dimension : %d x %d Frame rate : UNKNOWN %d Fps Total Time : Video Codec : Bit rate : %d Kbps Audio Sample rate : %.1f KHz Bit rate : error : not supported attribute MJPEG MPEG4 MPEG2 MPEG1 WMV9 JPEG H264 G.726 NONE WMAV1 WMAV2 GSMAMR G723 ARM AAC ARM MP2 ARM MP3 can not adapt the time to kernel current sec : %x current min : %x current hour : %x current day : %x current month : %x current year : %x LINE-IN EXT-MIC INT-MIC LINE-IN selected... EXT-IN selected... INT-IN selected... err, path is %x Video_SEL_process Video_SELL_process Video_RIGHT_process Video_RIGHTL_process Video_RIGHTS_process Video_LEFT_process Video_LEFTL_process Video_LEFTS_process Video_UP_process Video_UPL_process Video_DOWN_process Video_DOWNL_process Video_AB_process delete ab function Video_ABL_process Video_NAVI_process Video_NAVIL_process Video_PLAY_process %s%s playing the file %s... Video_STOPS_process Video_Mch_filePls_process set_voleme [ymalloc] create malloc error [ymalloc] memory region is not vaild [ymalloc] already use id %d [ymalloc] id %d pool is not created [ymalloc] id : %d size %#x is too big mem pool num is over Afrikaans Albania Basque Byelorussian Bulgarian Catalan Chinese(Simple) Chinese(Tradition) Croatia Czech Danish Dutch English Estonian Faeroese Finnish French German Hungarian Icelandic Indonesian Italian Japanese Korean Latvian Lithuanian Norwegian Polish Portuguese Romanian Russian Serbian Slovak Slovenian Spanish Swedish Turkish Ukrainian Other [BROWSER] It's changed to the browser [INFO] To be implemented [Loading] .... File loading...... [Record] Preparing for record Wait a second, please. [Record] Finishing record Wait a second, please. [Load Default] Are you sure ? [F/W [F/W Upgrade] Unpacking the upgrade file. [F/W [F/W Upgrade] xxx Upgrade to xxx. Are you sure ? [F/W [F/W Upgrade] F/W upgrade is, not found [F/W [F/W Upgrade] Problem on the F/W upgrade file. [F/W [F/W Upgrade] Firmware Upgrading... [F/W [F/W Upgrade] F/W upgrade is succeeded. To complete upgrade, plz Turn off the device & turn on it again [F/W [F/W Upgrade] F/W Upgrade has Fail Plz Retry [Clock] Time is changed. [Copying] :Unknown ********** (10%) ) / 10( File:Unknown ********** (10%) ) / 10( [COPY] :Unknown File:Unknown ) / 10( 3(Cur) / 10(Total) [USB [USB HOST] USB USB Device is connected. [TV [TV OUT] Display is changed to TV. [LCD [LCD OUT] LCD Display is changed to LCD. mpeg jpeg text Select All Play Move Delete Copy Select All Delete Copy Select All Add List Play New List Load List Select All Add List Play New List Load List DB Scan Select All Add List Play New List Browser Select All Del List Play Save List DB Scan Select All Del List Play Save List Browser Select All Del List Play Save List TIT2 TPE1 TALB TCON USLT ]MODE : ]linux. ]fs.img >LoadAddr >EntryAddr >NumBytes Afrikaans /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Albania /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Basque /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Byelorussian /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Bulgarian /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Catalan /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Chinese(S) /mnt/Root/iRiverSys//nls/nls_cp936.o codepage=936,iocharset=cp936 Chinese(T) /mnt/Root/iRiverSys//nls/nls_cp950.o codepage=950,iocharset=cp950 Croatia /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Czech /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Danish /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Dutch /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 English /mnt/Root/iRiverSys//nls/nls_cp949.o codepage=949,iocharset=cp949 Estonian /mnt/Root/iRiverSys//nls/nls_iso8859-13.o iocharset=iso8859-13 Faeroese /mnt/Root/iRiverSys//nls/nls_iso8859-13.o iocharset=iso8859-13 Finish /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 French /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 German /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Hungarian /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Icelandic /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Indonesian /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Italian /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Japanese /mnt/Root/iRiverSys//nls/nls_cp932.o codepage=932,iocharset=cp932 Korean /mnt/Root/iRiverSys//nls/nls_cp949.o codepage=949,iocharset=cp949 Latvian /mnt/Root/iRiverSys//nls/nls_iso8859-13.o iocharset=iso8859-13 Lithuanian /mnt/Root/iRiverSys//nls/nls_iso8859-13.o iocharset=iso8859-13 Norweigian /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Polish /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Portuguese /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Romanian /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Russian /mnt/Root/iRiverSys//nls/nls_iso8859-5.o iocharset=iso8859-5 Serbian /mnt/Root/iRiverSys//nls/nls_iso8859-5.o iocharset=iso8859-5 Slovak /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Slovenian /mnt/Root/iRiverSys//nls/nls_iso8859-2.o iocharset=iso8859-2 Spanish /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Swedish /mnt/Root/iRiverSys//nls/nls_iso8859-15.o iocharset=iso8859-15 Turkish /mnt/Root/iRiverSys//nls/nls_iso8859-9.o iocharset=iso8859-9 Ukrainian /mnt/Root/iRiverSys//nls/nls_iso8859-5.o iocharset=iso8859-5 Select Right Left Volume Up Volume Down Power Off Select Playlist/Setup Next/FF Prev/RW Volume Up Volume Down Power Off Pause/Play Stop Playlist Setup Play Mode Playlist/Setup - / - /FF - / - /RW Volume Up Volume Down Power Off Pause/Play Stop Playlist Setup Info Repeat Mode Playlist/Setup - / - /FF - / - /RW Volume Up Volume Down Power Off Pause/Play Stop Playlist Setup Info Repeat Mode Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info Playlist/Setup Next/Scroll Prev/Scroll Scroll Up Scroll Down Power Off Stop Playlist Setup Zoom Rotate Info /Setup Next Freq Prev Freq Volume Up Volume Down Power Off Memory Cancel Menu Preset Off/On Preset Off/On Setup Stereo Off/On Stereo Off/On Memory Auto Memory Select/Popup Sub Dir Up Dir Cursor Up Cursor Down Power Off Play Menu Select All Clear All Browser/Playlist /Setup Power Off Record/Pause Play Stop Setup Setup(Record) Select/Prev Mode Cursor Right Cursor Left Cursor Up Cursor Down Power Off Select Prev Mode Select Prev Mode Set/Prev Mode Change Value Change Value Cursor Up Cursor Down Power Off Prev Mode Prev Mode Video Photo Music Radio Record Setup Browser Preparing for F/W upgrade. Wait a second, please. Do not operate during F/W upgrade. Firmware Upgrading... Do not operate during F/W upgrade. F/W upgrade file is not found. F/W upgrade file is incorrect. F/W upgrade is succeeded. Please turn off the device and turn on it again F/W upgrade has failed. Video Photo Music Radio Record Setup Browser Firmware Upgrade sighdd xFLT /opt/bsp/dm270/uclinux-2.4/crossdev/arm-uclinux/lib libc-xflat.so share_init GIO_makeOutput GIO_write ING_hardDriveControlWakeUp _start GIO_read main GIO_init ING_hardDriveControlStandby SetPriorityLevel GIO_makeInput ioctl printf sigemptyset getpid shmat perror sleep sched_setscheduler xflat_signal write fprintf xflat_varptr shmget sync xflat_sigaction __uClibc_main memset sprintf exit strlen open close shmget error shmat error HDIO_DRIVE_CMD[standby] failed HDIO_DRIVE_CMD(SETIDLE) failed /mnt/ramdisk/sighdd_id /dev/hda1 Failed to install SIGUSR1 handler, errno=%d Failed to install SIGALRM handler, errno=%d @xFLT |fboot2nd xFLT libc-xflat.so get_vid_win1_position put_rectcursor_size OSD_FGET put_rectcursor_position put_osd_win0_var close_frame_buffers get_rectcursor_size OSD_RAMCLUT_SET enable_osd_win1 put_vid_win0_mode put_vid_win0_position map_frame_buffers put_osd_win1_var put_var_info get_rectcursor_position enable_vid_win1 get_vid_win0_position get_vid_win1_mode put_video_mode get_fix_info _start put_osd_win0_mode OSDPaintQuadrangle enable_rectcursor put_rectcursor_mode get_osd_win0_mode put_vid_win1_var get_osd_win1_position main enable_vid_win0 get_var_info OSD_RSET get_video_mode enable_osd_win0 get_rectcursor_mode put_osd_win0_position put_osd_win1_mode open_frame_buffers dsp_booting get_vid_win0_mode get_osd_win1_mode enable_video unmap_frame_buffers put_osd_win1_position put_vid_win1_position put_vid_win0_var put_vid_win1_mode get_osd_win0_position ioctl munmap mmap fprintf xflat_varptr __uClibc_main __errno_location exit open close /dev/fb0 /dev/fb1 /dev/fb2 /dev/fb3 failed to open %s, errno=%d Failed to open %s, errno=%d Failed to close %s, errno=%d Failed to get fix info for video win0, errno=%d Failed to get fix info for video win1, errno=%d Failed to get fix info for OSD win0, errno=%d Failed to get fix info for OSD win1, errno=%d Failed to get var info for video win0, errno=%d Failed to get var info for video win1, errno=%d Failed to get var info for OSD win0, errno=%d Failed to get var info for OSD win1, errno=%d Failed to put var info for video win0, errno=%d Failed to put var info for video win1, errno=%d Failed to put var info for OSD win0, errno=%d Failed to put var info for OSD win1, errno=%d Failed to get position win0, errno=%d Failed to get position win1, errno=%d Failed to put position win0, errno=%d Failed to put position win1, errno=%d Failed to get rectangular cursor position, errno=%d Failed to put rectangular cursor position, errno=%d Failed to get rectangular cursor size, errno=%d Failed to put rectangular cursor size, errno=%d Failed to get video_mode, errno=%d Failed to put video_mode, errno=%d Failed to get video Win0 mode, errno=%d Failed to get video Win1 mode, errno=%d Failed to get OSD Win0 mode, errno=%d Failed to get OSD Win1 mode, errno=%d Failed to put video Win0 mode, errno=%d Failed to put video Win1 mode, errno=%d Failed to put OSD Win0 mode, errno=%d Failed to put OSD Win1 mode, errno=%d Failed to get rectcursor_mode, errno=%d Failed to put rectcursor_mode, errno=%d Failed to get mmap video win0, errno=%d Failed to get mmap video win1, errno=%d Failed to get mmap OSD win0, errno=%d Failed to get mmap OSD win1, errno=%d Failed to unmap video win0, errno=%d Failed to unmap video win1, errno=%d Failed to unmap OSD win0, errno=%d Failed to unmap OSD win1, errno=%d OOOOOO OOOOO OOOOO KKKKKKO OOOOO KKKKKKKKKKOO OOOOO KKKKKKKKNNNNK OOOOO KKKKKKKKNKNNNNN OOOOO KKKKKKKKNNNNNNN OOOOO KKKKKKKKNKNNNNN OOOOO KKKKKKKKNNNNNNN p}}}}}ppp NI~p}}}}p}pu} OOOOO KKKKKKKKNKNNNNN ~onnnnnnnnmu -smnnnnnnnmyJ OOOOO KKKKKKKKNNNNNNN JNhurllmmmmmmm} okmmmmmmmk KKKKKKKKOOO OOOOO KKKKKKKKNKNNNNN ynqtqqtqtqo urqtqtqtqqrpj NKIJ OOOO KKKKKKKKNNNNNNN sv{t{{t{tvy-JI u{t{t{t{{v KKKKKKKKNKNNNNN JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ IINJJJ JJJJJ NIIII JJJJJJJ JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ OOOOO KKKKKKKKNNNNNNN NNKOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOKN KOOOKKKNNNNNKOO OOOOOOOO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO KKKKKKKKNKNNNNN KOOOO KKKKKKKKNNNNNNN _________ uuuuuuuu ~uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuup}} _________ uuuuuuup ~puuuuuup ~}}uuuuuuuuuuuuuuuuuuuuuuuuup} }}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}} KKKKKKKNKNNNNN omnnnnnnnny yinnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnooosyu sinnnnnnioosu huyorinnnnis~ }usooonnnnnnnnnnnnnnnnnnnnnnnnnroosu sooooooooooooooooooooooooooooooooooooooooooooooosyp OOKKKKKNNNNNNN rllmlmlmlk} skiliiliiliiliiliiliiliiliiliiliiliiliiliiliiliiikkkkkisu hhhhxkliliililkkns psnkkiililiks yoikilkiiilililililililililililiiilkixp hunkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkikinsu KOKKKNKNNNNN urttqtqtqtt OK~rimmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmilkn ~oimmmmmmmmmmlko~JI urklimmmmmmmkyhpxillmmmimmmmmmmmmmmmmmmmmmmmmmmmmmlmimkrp yiimmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmlkmy KOKNNNNNN JJJIKK ywt{t{t{ttxI lmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmlnpOK J,I,KOO unlmmmmmmmmmmmmls,KJ jynkmmmmmmmmmlmpprimmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmlo hskmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmliy KKKNNN Kukmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmqmmmx IINNKKOO hymmmmmmmmmmmmmmmmuO jymlqmmmmmmmmmlo olmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmny xlqmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmlm JJKK ~ylqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqmr KKKO slqqqqqqqqqqqqqqlo jyqmqqqqqqqqqqqqoolqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqls pomqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqlx olqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqrp olqqqqqqqqqqqqqqqq}I unmqqqqqqqqqqqqmrnqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqlx qlqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqmo ~ppppppppp rwrwrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrlqqtqqtqqtqruj }ppppppppuotrwrrrqqqqtqqtqql prltqqtqqqqktrrrwtqqqtqqtqqqlqrrrrrrrrrrrrrrrrrrrrwqltqqtqqtqqx yqrwrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrtqqqtqqtqqtqruI IKhynorororors uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuy tqttqttqtr uuuuuu qtqttqttqx- ltqttqttqxyuuuusrqttqttttqts uuuuuuuuuuuuuuuuuuuuuyxqttqttttlxj }uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuy qqttqtttqru okkilikikky jjhh qtttttttq zqvqvqvqlx rttttttttt~ qtttttttqx ytttttttttty kttttttqvs hhylttttttqvo olmmmmmmmkph,- uqtttttttto sqtttttttzyj qtttttttqu qtttttttq svqttttttqs yvtttttttts yvtttttttvx} urmmmmmmmmn} ttttttttw xvtttttttt hsvtttttttts wtttttttv|p xvtttttttzu }swtttttttt yrttttttttvyI hymqqqqqqqlo xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx|t{w{w{w{t|} p|tt{w{w{t y|twtw{wt{|,K JJJJOI xvt{w{w{tw tt{w{w{tw} sxxxxxxxxxxxxxxxxxxx wttwtw{wtvx,-J ysxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx wvt{t{wt{t| slqqqqqqqqs,J |tvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv{t{{t{t{{t uv{{w{{t{vx {{{{t{{{t jytw{w{t{t{s |{{w{t{{vx~ |vvvvvvvvvvvvvvvvvvvt{{{{{{{t{wyK |vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvt{w{w{w{{{vs ~xqtttttttk v{{{{w{{w{{w{{w{{w{{w{{w{{w{{w{{w{{w{{w{{w{{|}h v{{{{w{{v x{{w{w{w{{yO, {{{{{w{v yv{w{{w{wvy |{{{w{{w{{w{{w{{w{{w{{{w{w{w{vx- x{{{{w{w{{w{{w{{w{{w{{w{{w{{w{{w{{w{{{{{{{{{wv| qtttttttwuK JJJJ wvyI INKNO JIIh ttttttttq JJJJ JKKK yvt{wtwt{vs JNNNNNNNNNNNNNNNNKNK NNNNNN v{w{{{{wv NNOOOOOOOOOOOOO NNNNNNNNNNNNNNN KKKKKNKI w{{v IJJKOOO JNNNKKKKKKKKKKKKKKK OOKKKJK }}}}}}}}}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}} }}}}}}}}}}}}}}}}}}}}}}} OOOOK IIIOOOOOOOOOOOOOOOOOO JNKJ ,KKO KKK, IIKJ ,,I, NKOOOKJ JJKKK NNKO IKKO JNNKKK NKOOOOOOOOOOOOOOOOOO NNKKKKNKJ NNNKKK IKJ NNNKKK J,Oj JO,- NNNKNJJ NKKKKKKKKKKKKKKKKKK J,-II--, IIIIKIKIKIKIKIKI--, KKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKII-, NNNNNN KKKIN NNNNNN ,,KKKKKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIKIK KKIKIKIKIKIKIKIKIKIKIKIKI--, NNNNNNNNNNNNNNNNNNN NNNN NNNNN NNNNNNNNNNNNNNNNNNN zzzzz zzzz zzzzz zzzzzz zzzzz zzzzzz zzzzzz zzzz zzzzzz zzzz zzzz zzzzz zzzzzz zzzzz zzzz zzzz zzzz zzzzz zzzzz zzzzz zzzzz zzzzz zzzzz zzzz zzzzz zzzzz zzzzzz zzzzzz zzzzzz zzzz zzzzz zzzzzz zzzzzz zzzz zzzzzz zzzz zzzzzz zzzz zzzz zzzzzz zzzzzz mmmm mmmm mmmm mmmmmm mmmm mmmmmm ymmmmmmmmh mmmmmm mimmmlu mmmmmi vmmmm hmmmm mmmmmmm mmmmmmms yymmmmmmmmmmmmmmi mmmmmmmmmhhmmmmymimmmm mmmimmimy {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{v y|{{{ {{{{{{{{{{{{{{{mm mm{{|mmmmmmmmmmmmmmmmmmmmm mmmmmmmmmmmmmmmmmmmmmmmmmm| mmmmmmmmmmmmmmmmmmmmmmmmmm mmmmmmmmmmmmmmmmmmmmmyv {||| |||||| |||| |||{yy |||{ux{{{{{{{{{{{{{{{{ {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{vx |{{{v v{{{{{{{{{{{{{{mm mm{{mmm mmmmhh mmmm mmmmh hhhmmmmh mm{{y {|mmm mmmhhhhhmmh hhmmmh mmmv uv{{{v sv{{{v |v{{v v{{{vyx{xy{{{{{ pv|y v{{v v{{{v v{{{z {{{{{{{{{{{{{{{ {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{vxy|v{{{ {{{{{{{{{{{{{{{mm mm{{mmh mmmmmm mmmm mmmm v|mm mmmmmm mmmmmmm mmmmm v{{{{ v{{{vy |{{{v {{{{vyx{ y{{{{{w v{{{ v{{{vsyz yxv{{{v xv{{{{{{{{{{{{{{{ {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{vx wvvvz|y v{{{{{{{{{{{{{{mm mm{tmm hmmmmmm mmmm mmmm mm{wyxv|mm mmmmmm mmmmmmm mmmmm mmv|uvt{{v wssv{t{vsyzxy|v{{{ vt{{vyx{xy{{{{{w t{{t|s z{t{v xv{{{vuxv{{{{{{{{{{{{{{{{ttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttvx vttttttttttttttmm mmttmm mmmm mmmm mmvty vwmmm hmmmm mmvmm mmmmmmmvvvmmmmqxvvvvz swvtvv|y vvvvvyxt ytvtvvtpvwy vvvvt ztvtzsyzry vvvtz xvttttttttttttttt{tttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttrss ssxrtttttttttttttttmm mmmmmm mmmm mmmm uovr mmmmm mmmmmm mmmmm mmmmmm mmmmmmmm immmmmm| ykxyx oyszsur yz|ys ruxqttttttttttttttt{tttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttwwtwwwwttttttttttttttttmm mmmmmm mmmm mmmm mmyy rttmmmmmm mmmmmm mmmmm mmmmmm mmymm mmyyyyyuxv yyyyyy srvsyyyyyy yyyyyyyqts yyyyyy uyyyyy xqws yyyyy vtttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttqtqtqtqtqttttttttttttttmm mmmm mmrrrtttmmhh mmmm mmmmm hmmm mmrmm mmrrrrrrwqtrrrrrrrwtqwrrrrrrrttqrrrrrrrtqtwrrrrrrrtttrrrrrrrwqtwrrrrrrrqtqtttttttttttttt{qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqllklklklqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqtqqqqqqqqqqqqqqmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm mmqvqqqqmmmmmmmmmmmmm mmmmmmmmmmqmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmqmmmmmmmqvqqvqqqqqqvqvqqqqtqqqvqvqqtqqqqvqvqvqtqqqvqvqvqqqqqqvqvqqqtqqqqvqqvqtqqqqqqqqqqqqqqqqtqqqqqqqqqqqqqqqqqqqqqqqqqqqqqt rqqqqw yqqqqtr rtqqtqr rwqqw tqqr tqqr ommmmmmmmrmmmmmmrnmmmmmmm mmmmmmmmmmmmmmmmmmmmmmmmmmmm ortqtrmmmmmmmmmmm mmmmmmmmmmo mmmmmmommmmmmqmmmm mmmmrmmmmm mmmmmo rqtr rtqw orqqr ortqt rqqr ortqw ntqqqqqtqqqqqqqqqqqqqqqqqqqqqqqqqqqqls yyyyy yrqqqoyorrr rpqqqqtuyyyyyyurqqqtsuyyyyyuslkyuyyyyypoqku yyyyypxqquyyyyyyu yyyyy xlnsuyyyyyuslkyuyyyyy}oqku yyyymmh mmmyyu yyyyymmh mmmyyuxks yyyyyusnkuyyyyyy}nqs yyyyy slruyyyyy rqsuyyyyyusko yyyyy yrkyyyyyyyuxqouyyyyyy yyyyy xlx}yyyyyuskwyuyyyyyuoky yyyyyuxqqqqqq{qqqqqqqqqqqqqqqqqqqqqqqqqqqqkysnnnnnoyrqqloynqqqmlpqqqqnpnnnnnoy mqqnssmnnnqsylkysqnnnmuxlkuonnnnmyxqlprnnrnryomnyonnnrrsslrssqnrnmysklysqrnnmuolluonnrnmmmmmmmmmnrryolryonnrnrmmmmmmmmrnmyskysqnnnnsstkuonrnnn}tmyxnrnnrxylrpqnnnnoyrnssqnnnmyykxyrnnnnoyrkuonnnnnyxqoyrnnnnr lnyonnnnrsskoumnnnmyykryxnnnnmuokuonnnnnyxqqqqqqtmqqqqqqqqqqqqqqqqqqqqqqqqqqqkyslmqmmryrmqqryrmqmqm qqqqnplqmqmnyolqqnsslqmqlsykkyslmmqk olkuommqmlyxqqpqqqmmqyomnyomqqmnsslnsslqmmlsylkyslmmqk oqkurmqmmlmmmmmmmmqmnyomnyolqmmnsmmmmmmmmqkyskyslqqqlssnkurlmmqlpnmyommmmqoylrukqqqmryrnsslmqqlsskxsnmqqlryrkurmmqqlyomoyqmqqqnplnyomqqmnsskx kqqqlsskrsolmqqk ommqmlyxnqqqqqtmmmmmmmmmmmmmmmmmmmmmmmmmmmmkyskmmmlryrmmloynmmmmlpmmmmqplmmmmnyrlmmnsskmmmlsyklsskmmmk olkuolmmmlsonlpqmmmmqyolnyolmmmnssknsxlmmmksslkyskmmmk olkuolmmmlpnmmpmmmmmqyolnyrmmmmnssknsxlmmmkyskyxlmmmlssqkurmqmml qlyommmmqxslrpkmmmlryrnsxlmmmksykxsrmmmlryrkuolmmmlsxmoymmmmmqplnyolmmmnssko kmmmksskryolmmmk olmmmlsonmmmmmtmmmmmmmmmmmmmmmmmmmmmmmmmmmmkyskmmmmryrlmloynmmmmlpmmmmnplmmmmnyolmmnsskmmmksslkyslmmmk olkurmmmmlyonlpmmmmmmyolnyolmmmqssknsskmmmlsykkyxlmmmk olkurmmmmlpnmmpmmmmmnyolnyolmmmnssknsskmmmkyskyskmmmkssnkurmmmmlpnlyommmmmoylrukmmmmryrnsskmmmlsskosnmmmmryrkurmmmmlyomoymmmmmnpknyolmmmqssko kmmmlsyknsolmmmk okurmmmmlyommmmmmtmmmmmmmmmmmmmmmmmmmmmmmmmmmmksslmmmiryrmmirynlllllpmmmmmplmmmmnyrlmlnxslmmmlsyklsskmmmk olkuolmmmisxmlpmmmmmmyolnyolmminxsknsslmmmlsskkyskmmmk olkuolmmmkpnmlpmmmmmmyolnyrlmmlnxsknsolmmmkssksslmmmksxnkurlmmmlpmiyommmmnoslrukmmminyrmsslmmmkyskssnlmmiryrkuolmmmlyomoymmmmmmpknyolmminxsko kmmmksskrsolmmmkuokuolmmmisxmmmmmmqmimimimimimimimimimimimimimikyoklllinyniiirpyysyys}miminpklllinyoiminsoklliksskkyskllikyolkurklllkyomipilllliyoinyrklllissknsoklliksykkyokllik oikurklllkpnmipllllimsoinyrllllissknsoklllkyskyoklllkssnkurilllkpniyollllioyinuklllinynnsoklliksskosnlllinynkurklliksoioyillllmpknyrklllisskoyklllksskrsokllik okurklllkyomimimiqiiiiiiiiiiiiiiiiiiiiiiiiiiiikspppppp}yniiinooooooooiiiimuppppppuniiims ppppppoiks}ppppp~oik pppppp}oiiypppppppniis}pppppuokis ppppppoiks ppppp okkupppppp}nii ppppppprimyppppppuokis~ppppppokopppppp}sikupppppp}mispppppppoinuppppp}unis ppppp skouppppp}ynkspppppp oirpppppppyiis}pppppuoko ppppp skiy}pppppurkspppppp}oiiiiiiqiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiqiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiqiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiFailed to put var info for OSD win0, errno=%d Failed to put position win0, errno=%d Failed to put var info for OSD win1, errno=%d Failed to put position win1, errno=%d @mqyo hhddfreespace xFLT libc-xflat.so IDE_FinalDrive ChangeHddFSINFOfreeCount IDE_BufferSectorMulti FAT32_FindFSINFODetails IDE_SectorWriteByte FAT32_FindFAT32Details IDE_InitDrive __udivsi3 IDE_Print_Internal _start IDE_SectorWriteUI32 IDE_BufferSectorWrite main __div0 FAT32_FindFreeClusterCount print_time IDE_SectorByte IDE_BufferSectorFromMulti IDE_SectorWord IDE_SectorUI32 IDE_BufferSector printf strerror lseek write fprintf xflat_varptr read __uClibc_main time sprintf open close @ #! /dev/hda1 Free Size : %d SectorCurrentlyLoaded : %#x maxLBA : %#x currentsector========== [0x%2x] HALT:: Unable to open disc IDE_BufferSectorWrite error : %d, %d c_time : %d Error: Bytes per cluster is not 512 Error: Incorrect Volume Signature s.'bin ../../bin/busybox which ../../bin/busybox passwd ../../bin/tinylogin {1ptail ../../bin/busybox ../../bin/busybox ../../bin/busybox killall ../../bin/busybox ../../bin/busybox ../../bin/busybox g%\cut ../../bin/busybox head ../../bin/busybox s*xfind ../../bin/busybox ../../bin/busybox telnet ../../bin/busybox dirname ../../bin/busybox *p2{clear ../../bin/busybox w$7reset ../../bin/busybox }nslookup ../../bin/busybox Rbasename ../../bin/busybox j1wfree ../../bin/busybox (x5(rdate ../../bin/busybox whoami ../../bin/busybox test ../../bin/busybox !suptime ../../bin/busybox time ../../bin/busybox o%ntmp mnt/ramdisk/tmp yroot mnt/ramdisk/root